PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.015G039600.1 | ||||||||
Common Name | POPTR_0015s04460g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 65aa MW: 7486.68 Da PI: 10.9077 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.2 | 5.1e-15 | 6 | 53 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l+ v+++G g+W t +++ g R++k+ +++w +yl Potri.015G039600.1 6 RGSWTQEEDKKLLAFVEKHGHGSWQTLPAKAGFQRCGKSYRLKWINYL 53 89******************************66************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.037 | 1 | 57 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-21 | 2 | 62 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-9 | 5 | 55 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-14 | 6 | 53 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 8.28E-17 | 7 | 63 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.92E-8 | 8 | 53 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 65 aa Download sequence Send to blast |
NKGLKRGSWT QEEDKKLLAF VEKHGHGSWQ TLPAKAGFQR CGKSYRLKWI NYLRPDIKKA 60 KFNP* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in trichomes, epidermis and mesophyll cells of young leaves, stems, petals, sepals, carpels and stamens. {ECO:0000269|PubMed:23709630}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269|PubMed:17376813, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.015G039600.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007153566.1 | 7e-29 | hypothetical protein PHAVU_003G0464001g, partial | ||||
Refseq | XP_018806959.1 | 9e-29 | PREDICTED: myb-related protein Myb4-like | ||||
Refseq | XP_021889670.1 | 2e-28 | LOW QUALITY PROTEIN: transcription factor MYB16-like | ||||
Refseq | XP_028061600.1 | 9e-29 | transcription factor MYB106-like | ||||
Swissprot | Q9LXF1 | 1e-27 | MYB16_ARATH; Transcription factor MYB16 | ||||
TrEMBL | A0A2K1XHQ8 | 6e-40 | A0A2K1XHQ8_POPTR; Uncharacterized protein (Fragment) | ||||
STRING | POPTR_0015s04460.1 | 2e-40 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G15310.1 | 5e-30 | myb domain protein 16 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.015G039600.1 |
Entrez Gene | 18105558 |
Publications ? help Back to Top | |||
---|---|---|---|
|