PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G039600.1
Common NamePOPTR_0015s04460g
Organism
Populus trichocarpa
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 65aa    MW: 7486.68 Da    PI: 10.9077
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G039600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25.1e-15653148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT+eEd++l+  v+++G g+W t +++ g  R++k+ +++w +yl
  Potri.015G039600.1  6 RGSWTQEEDKKLLAFVEKHGHGSWQTLPAKAGFQRCGKSYRLKWINYL 53
                        89******************************66************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.037157IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-21262IPR009057Homeodomain-like
SMARTSM007172.2E-9555IPR001005SANT/Myb domain
PfamPF002492.5E-14653IPR001005SANT/Myb domain
SuperFamilySSF466898.28E-17763IPR009057Homeodomain-like
CDDcd001675.92E-8853No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 65 aa     Download sequence    Send to blast
NKGLKRGSWT QEEDKKLLAF VEKHGHGSWQ TLPAKAGFQR CGKSYRLKWI NYLRPDIKKA  60
KFNP*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in trichomes, epidermis and mesophyll cells of young leaves, stems, petals, sepals, carpels and stamens. {ECO:0000269|PubMed:23709630}.
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269|PubMed:17376813, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.015G039600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153566.17e-29hypothetical protein PHAVU_003G0464001g, partial
RefseqXP_018806959.19e-29PREDICTED: myb-related protein Myb4-like
RefseqXP_021889670.12e-28LOW QUALITY PROTEIN: transcription factor MYB16-like
RefseqXP_028061600.19e-29transcription factor MYB106-like
SwissprotQ9LXF11e-27MYB16_ARATH; Transcription factor MYB16
TrEMBLA0A2K1XHQ86e-40A0A2K1XHQ8_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0015s04460.12e-40(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.15e-30myb domain protein 16
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Huang BH, et al.
    Positive selection and functional divergence of R2R3-MYB paralogous genes expressed in inflorescence buds of Scutellaria species (Labiatae).
    Int J Mol Sci, 2015. 16(3): p. 5900-21
    [PMID:25782156]
  4. Cui F, et al.
    Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation.
    Mol Plant, 2016. 9(6): p. 926-38
    [PMID:27060495]