PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.014G064600.1 | ||||||||
Common Name | POPTR_0013s10770g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 123aa MW: 14836.8 Da PI: 9.3663 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 34.6 | 5.7e-11 | 44 | 80 | 55 | 91 |
NAM 55 ekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 + +wyfF +rd++y+tg r+nrat++g Wkatg+d++ Potri.014G064600.1 44 DWQWYFFGPRDRRYHTGARSNRATRQGWWKATGRDRS 80 4589******************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 13.277 | 1 | 122 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.4E-13 | 14 | 97 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 2.22E-29 | 14 | 120 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 123 aa Download sequence Send to blast |
MILEEISSLL EGWFAPTDVE LVLYYLKRKI CEKRFELDII RDSDWQWYFF GPRDRRYHTG 60 ARSNRATRQG WWKATGRDRS RAPRGERTDW KMQEYTLSEE ELRGRANVQD FYALYKLCKK 120 GE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-19 | 8 | 120 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-19 | 8 | 120 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-19 | 8 | 120 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-19 | 8 | 120 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 6e-19 | 8 | 120 | 19 | 168 | NAC domain-containing protein 19 |
3swm_B | 6e-19 | 8 | 120 | 19 | 168 | NAC domain-containing protein 19 |
3swm_C | 6e-19 | 8 | 120 | 19 | 168 | NAC domain-containing protein 19 |
3swm_D | 6e-19 | 8 | 120 | 19 | 168 | NAC domain-containing protein 19 |
3swp_A | 6e-19 | 8 | 120 | 19 | 168 | NAC domain-containing protein 19 |
3swp_B | 6e-19 | 8 | 120 | 19 | 168 | NAC domain-containing protein 19 |
3swp_C | 6e-19 | 8 | 120 | 19 | 168 | NAC domain-containing protein 19 |
3swp_D | 6e-19 | 8 | 120 | 19 | 168 | NAC domain-containing protein 19 |
4dul_A | 5e-19 | 8 | 120 | 16 | 165 | NAC domain-containing protein 19 |
4dul_B | 5e-19 | 8 | 120 | 16 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pth.11987 | 5e-34 | bud| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers. {ECO:0000269|PubMed:17158162}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Transcriptional activator that acts as positive regulator of AOX1A during mitochondrial dysfunction. Binds directly to AOX1A promoter. Mediates mitochondrial retrograde signaling. {ECO:0000269|PubMed:24045017}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.014G064600.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold and drought stresses. {ECO:0000269|PubMed:17158162}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ513224 | 4e-31 | DQ513224.1 Populus trichocarpa clone 528929 TIR-NBS-LRR-TIR type disease resistance protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011011973.1 | 4e-64 | PREDICTED: NAC domain-containing protein 86-like | ||||
Swissprot | Q9XIC5 | 4e-34 | NAC17_ARATH; NAC domain-containing protein 17 | ||||
TrEMBL | A0A2K1XRC5 | 1e-84 | A0A2K1XRC5_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0013s10770.1 | 5e-83 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G34190.1 | 2e-36 | NAC domain containing protein 17 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.014G064600.1 |
Entrez Gene | 18104373 |