PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.012G133000.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 170aa MW: 19482.6 Da PI: 10.1668 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.3 | 4.7e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskR+ng+lKKA+ELS+LCdaevaviifs++g+l+ ++s Potri.012G133000.3 9 KRIENATSRQVTFSKRKNGLLKKAYELSILCDAEVAVIIFSQKGTLFKFAS 59 79**********************************************986 PP | |||||||
2 | K-box | 66.4 | 1e-22 | 83 | 158 | 9 | 84 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 e+ e+l+qe+a++ k+ie ++ qR+llG+dL+s+s +eL+ + +qLe sl++iR++K++l++eqie+lq k Potri.012G133000.3 83 DVEQSKEQLRQESANMAKKIEIIEILQRKLLGQDLDSCSPEELHDIDNQLEISLSNIRARKTQLFKEQIEQLQAKV 158 44566889*****************************************************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.8E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.006 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.52E-37 | 2 | 79 | No hit | No description |
SuperFamily | SSF55455 | 2.09E-29 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.8E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.8E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.8E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 6.6E-21 | 86 | 157 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 12.612 | 88 | 169 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MARGKVQLKR IENATSRQVT FSKRKNGLLK KAYELSILCD AEVAVIIFSQ KGTLFKFASI 60 DQIQKTIDRY RKNAKQLHTD RIDVEQSKEQ LRQESANMAK KIEIIEILQR KLLGQDLDSC 120 SPEELHDIDN QLEISLSNIR ARKTQLFKEQ IEQLQAKVIR GVGLALQLY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 1e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_B | 1e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_C | 1e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_D | 1e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in quiescent center (QC) cells of root tips (PubMed:18162590, PubMed:21689171). Expressed at the base of the petiole of cotyledons and leaves, in flower buds, petals, sepals and abscission zone of flowers and siliques. {ECO:0000269|PubMed:18162590, ECO:0000269|PubMed:21689171}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.012G133000.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002318261.1 | 1e-108 | MADS-box protein AGL42 | ||||
Refseq | XP_024437836.1 | 1e-108 | MADS-box protein AGL42 | ||||
Swissprot | Q9FIS1 | 1e-60 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | B9I4G5 | 1e-107 | B9I4G5_POPTR; Uncharacterized protein | ||||
STRING | EOY23041 | 2e-69 | (Theobroma cacao) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 4e-63 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.012G133000.3 |