PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.012G132600.1 | ||||||||
Common Name | POPTR_0012s14020g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 234aa MW: 27068.9 Da PI: 8.5998 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 92.7 | 1.7e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +rienk+ rqvtfskRrng+lKKA+ELS LCdaeva+iifss+gkl+e+ss Potri.012G132600.1 9 ERIENKISRQVTFSKRRNGLLKKAYELSLLCDAEVALIIFSSHGKLFEFSS 59 69***********************************************96 PP | |||||||
2 | K-box | 92.8 | 6e-31 | 77 | 172 | 5 | 100 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 ++++ e+ + +l+qe+++L+++ e+Lqr+qR++lGedLe+L +keL+++e+qL+k l++ R++K++ll++++eel+ ke+el+eenk+L+ Potri.012G132600.1 77 QDTNIPEEGSHNLYQEVSRLRAKCETLQRSQRNFLGEDLEPLAFKELEKIEKQLDKTLSQARQRKTQLLFDKMEELRLKEQELEEENKQLK 167 55667888999******************************************************************************** PP K-box 96 kklee 100 +klee Potri.012G132600.1 168 TKLEE 172 **987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.441 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.3E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.12E-42 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 2.88E-32 | 2 | 83 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.6E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 15.018 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.1E-26 | 86 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 234 aa Download sequence Send to blast |
MGRGKVVLER IENKISRQVT FSKRRNGLLK KAYELSLLCD AEVALIIFSS HGKLFEFSSI 60 DMNSILQRYR QCCYSTQDTN IPEEGSHNLY QEVSRLRAKC ETLQRSQRNF LGEDLEPLAF 120 KELEKIEKQL DKTLSQARQR KTQLLFDKME ELRLKEQELE EENKQLKTKL EEVVLRLPAI 180 QGVGDPSKAD GYKHSEPLPT LQMGHHQFVY QEQAFDARTN IPGKSNPTPR WLS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-22 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 2e-22 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 2e-22 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 2e-22 | 1 | 69 | 1 | 69 | MEF2C |
6byy_A | 2e-22 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 2e-22 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 2e-22 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 2e-22 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_A | 3e-22 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_B | 3e-22 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_C | 3e-22 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_D | 3e-22 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and seeds. {ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.012G132600.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006377087.1 | 1e-173 | truncated transcription factor CAULIFLOWER A isoform X1 | ||||
Swissprot | Q8LLR1 | 1e-81 | MADS3_VITVI; Agamous-like MADS-box protein MADS3 | ||||
TrEMBL | U5FXL4 | 1e-171 | U5FXL4_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0012s14020.1 | 9e-86 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF229 | 32 | 178 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45650.1 | 7e-58 | AGAMOUS-like 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.012G132600.1 |
Entrez Gene | 7482158 |
Publications ? help Back to Top | |||
---|---|---|---|
|