PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.011G055900.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 145aa MW: 16188.8 Da PI: 7.0071 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 132.3 | 1.7e-41 | 60 | 136 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cq+++C++dl++ak+yhrrhkvCe+h+kap + v+gl+qrfCqqCsrfh+lsefD++krsCrrrLa+hnerrrk++a Potri.011G055900.1 60 CQADNCTSDLADAKRYHRRHKVCEFHAKAPFAPVNGLQQRFCQQCSRFHDLSEFDDSKRSCRRRLAGHNERRRKSSA 136 **************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 2.8E-58 | 1 | 144 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 5.8E-33 | 57 | 121 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.547 | 57 | 134 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 6.57E-39 | 58 | 138 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 7.5E-32 | 60 | 133 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
METSRAEGKR SLKEIEDEEE EEDDEDIAGG LGFVDDDKIK KKGKKGSSGG GSSSMLLVSC 60 QADNCTSDLA DAKRYHRRHK VCEFHAKAPF APVNGLQQRF CQQCSRFHDL SEFDDSKRSC 120 RRRLAGHNER RRKSSAEYQG EGSN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 5e-37 | 50 | 133 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pth.6244 | 0.0 | stem |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.011G055900.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006377387.2 | 1e-101 | squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q38741 | 2e-46 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A2K1YFY8 | 1e-100 | A0A2K1YFY8_POPTR; Squamosa promoter-binding-like protein | ||||
STRING | POPTR_0011s05480.1 | 1e-71 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 | Representative plant | OGRP97 | 17 | 230 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 9e-41 | squamosa promoter binding protein-like 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.011G055900.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|