PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Potri.009G055700.1

Common Name

POPTR_0009s06060g

Organism

Populus trichocarpa

Taxonomic ID

3694

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

MIKC_MADS

Protein Properties

Length: 272aa MW: 31046.7 Da PI: 7.1151

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Potri.009G055700.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	87.2	9.2e-28	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien+ rqvtfskRr+g+lKKA+EL +LCdaevavi+fs+tgkl+e+ss Potri.009G055700.1 9 KKIENTNSRQVTFSKRRAGLLKKAQELAILCDAEVAVIVFSNTGKLFEFSS 59 68***********************************************96 PP
2	K-box	62.9	1.3e-21	104	182	19	97
K-box 19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 +e++ Lk+ei +Lq +q +l G dL+ LslkeLqqLe+qL+++l +++kK++ll+eq+e+++ +e+++ en++Lr++ Potri.009G055700.1 104 KEVDVLKEEIAKLQVKQLRLSGMDLTGLSLKELQQLENQLNEGLLFVKEKKEHLLMEQLEQSRVQEQRAMLENETLRRQ 182 799**************************************************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.9E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.17	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.02E-44	2	72	No hit	No description
SuperFamily	SSF55455	3.79E-32	2	75	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.0E-28	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.3E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.0E-28	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.0E-28	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	12.065	99	189	IPR002487	Transcription factor, K-box
Pfam	PF01486	1.1E-15	104	182	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010047	Biological Process	fruit dehiscence
GO:0010262	Biological Process	somatic embryogenesis
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048577	Biological Process	negative regulation of short-day photoperiodism, flowering
GO:0060862	Biological Process	negative regulation of floral organ abscission
GO:0060867	Biological Process	fruit abscission
GO:0071365	Biological Process	cellular response to auxin stimulus
GO:2000692	Biological Process	negative regulation of seed maturation
GO:0005634	Cellular Component	nucleus
GO:0005737	Cellular Component	cytoplasm
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0042803	Molecular Function	protein homodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 272 aa Download sequence Send to blast
MGRGKIEIKK IENTNSRQVT FSKRRAGLLK KAQELAILCD AEVAVIVFSN TGKLFEFSSS 60 GMKRTLSRYN KFLDSPEQPK IEYKAEDHCP PQPPTQIKDK PDLKEVDVLK EEIAKLQVKQ 120 LRLSGMDLTG LSLKELQQLE NQLNEGLLFV KEKKEHLLME QLEQSRVQEQ RAMLENETLR 180 RQARIIEELR GFFPSTDHPV PTYLEYYATE RKNPPIDNGA TSPPVAHYIC SIEKVDSDTT 240 LHLGYAVFLA SFTLYPLSDW LHAAAYCFLF V*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	3e-20	1	72	1	72	MEF2C
5f28_B	3e-20	1	72	1	72	MEF2C
5f28_C	3e-20	1	72	1	72	MEF2C
5f28_D	3e-20	1	72	1	72	MEF2C
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During the reproductive phase, accumulates in immature buds and at the base of the floral organs, and in the receptacle, ovules, anther filaments, and stigma and style of open flowers. Accumulates before fertilization in the cytoplasm in the cells of the egg apparatus and moves into the nucleus during early stages of development following fertilization in the suspensor, embryo, and endosperm, mainly double fertilization derived tissues (at protein level). Highly expressed in developing embryos. In young seedlings, present in the shoot and root apices, lateral root primordia and throughout the vascular system. {ECO:0000269\|PubMed:10318690, ECO:0000269\|PubMed:10662856, ECO:0000269\|PubMed:15686521, ECO:0000269\|PubMed:17521410, ECO:0000269\|PubMed:8953767}.
Uniprot	TISSUE SPECIFICITY: Expressed at low levels in flowers and siliques. Also present in seedlings. Detected during embryogenesis and accumulates during early seed development (at protein level). Expressed in shoot apices and the base of leaf petioles. {ECO:0000269\|PubMed:10318690, ECO:0000269\|PubMed:10662856, ECO:0000269\|PubMed:12837945, ECO:0000269\|PubMed:12949148, ECO:0000269\|PubMed:15686521, ECO:0000269\|PubMed:16028119, ECO:0000269\|PubMed:17521410, ECO:0000269\|PubMed:8953767}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Acts as both an activator and a repressor of transcription. Binds DNA in a sequence-specific manner in large CArG motif 5'-CC (A/T)8 GG-3'. Participates probably in the regulation of programs active during the early stages of embryo development. Prevents premature perianth senescence and abscission, fruits development and seed desiccation. Stimulates the expression of at least DTA4, LEC2, FUS3, ABI3, AT4G38680/CSP2 and GRP2B/CSP4. Can enhance somatic embryo development in vitro. {ECO:0000269\|PubMed:10318690, ECO:0000269\|PubMed:10662856, ECO:0000269\|PubMed:12226488, ECO:0000269\|PubMed:12743119, ECO:0000269\|PubMed:14615187, ECO:0000269\|PubMed:15084721, ECO:0000269\|PubMed:15686521, ECO:0000269\|PubMed:17521410, ECO:0000269\|PubMed:18305206, ECO:0000269\|PubMed:19269998, ECO:0000269\|PubMed:19767455, ECO:0000269\|PubMed:8953767}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00508	DAP	Transfer from AT5G13790	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Potri.009G055700.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin (2,4-D). Feedback loop leading to direct down-regulation by itself. {ECO:0000269\|PubMed:15686521}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024463778.1	1e-160	agamous-like MADS-box protein AGL15 isoform X1
Swissprot	Q38847	5e-80	AGL15_ARATH; Agamous-like MADS-box protein AGL15
TrEMBL	A0A2K1Z3C2	1e-159	A0A2K1Z3C2_POPTR; Uncharacterized protein
STRING	POPTR_0009s06060.1	0.0	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF3582	32	60
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13790.1	8e-73	AGAMOUS-like 15

Link Out ? help Back to Top
Phytozome	Potri.009G055700.1
Entrez Gene	7467354

Publications ? help Back to Top
Zheng Q,Zheng Y,Perry SE Decreased GmAGL15 expression and reduced ethylene synthesis may contribute to reduced somatic embryogenesis in a poorly embryogenic cultivar of Glycine max. Plant Signal Behav, 2014. [PMID:23838957] Perry SE,Zheng Q,Zheng Y Transcriptome analysis indicates that GmAGAMOUS-Like 15 may enhance somatic embryogenesis by promoting a dedifferentiated state. Plant Signal Behav, 2016. 11(7): p. e1197463 [PMID:27302197] Cosio C, et al. The class III peroxidase PRX17 is a direct target of the MADS-box transcription factor AGAMOUS-LIKE15 (AGL15) and participates in lignified tissue formation. New Phytol., 2017. 213(1): p. 250-263 [PMID:27513887] Zheng Q,Zheng Y,Ji H,Burnie W,Perry SE Gene Regulation by the AGL15 Transcription Factor Reveals Hormone Interactions in Somatic Embryogenesis. Plant Physiol., 2016. 172(4): p. 2374-2387 [PMID:27794101] Chen N,Veerappan V,Abdelmageed H,Kang M,Allen RD HSI2/VAL1 Silences AGL15 to Regulate the Developmental Transition from Seed Maturation to Vegetative Growth in Arabidopsis. Plant Cell, 2018. 30(3): p. 600-619 [PMID:29475938]