PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.008G098500.1 | ||||||||
Common Name | POPTR_0008s09800g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 242aa MW: 28133.2 Da PI: 8.2111 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.3 | 3.2e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr+g+lKKA+E+SvLCdaeva+i+fs++gkl+eys+ Potri.008G098500.1 9 KRIENKINRQVTFSKRRTGLLKKAHEISVLCDAEVALIVFSHKGKLFEYST 59 79***********************************************96 PP | |||||||
2 | K-box | 98.6 | 9.2e-33 | 78 | 174 | 4 | 100 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 ++ ++++ + +++ e+++Lk+++e Lqr++Rh+lGedL+s slkeLq+Leqq++++lk iR++Kn+l++++i+elq kek+++e+n++L Potri.008G098500.1 78 RQLVATDLDSQGNWTLEYNRLKAKVELLQRNHRHYLGEDLDSVSLKELQNLEQQIDTALKLIRERKNHLMYQSISELQIKEKAIKEQNNML 168 5555555566789****************************************************************************** PP K-box 95 rkklee 100 k+++e Potri.008G098500.1 169 VKQIKE 174 ***986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.3E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.17 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.5E-33 | 2 | 91 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.42E-40 | 2 | 79 | No hit | No description |
PRINTS | PR00404 | 3.5E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 6.0E-27 | 86 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.322 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009933 | Biological Process | meristem structural organization | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 242 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRTGLLK KAHEISVLCD AEVALIVFSH KGKLFEYSTN 60 ACMEKILERH ERYSYAERQL VATDLDSQGN WTLEYNRLKA KVELLQRNHR HYLGEDLDSV 120 SLKELQNLEQ QIDTALKLIR ERKNHLMYQS ISELQIKEKA IKEQNNMLVK QIKEKEKALA 180 QPALWDQQDH GPNASSFLLP QLPLPCLNIS YQEEDPEARR NYELDLTLEP IYSCHLGCFG 240 T* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 3e-21 | 1 | 85 | 1 | 84 | MEF2 CHIMERA |
6byy_B | 3e-21 | 1 | 85 | 1 | 84 | MEF2 CHIMERA |
6byy_C | 3e-21 | 1 | 85 | 1 | 84 | MEF2 CHIMERA |
6byy_D | 3e-21 | 1 | 85 | 1 | 84 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pth.15990 | 0.0 | stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in tendrils and flowers. {ECO:0000269|PubMed:15247405}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00096 | ChIP-seq | Transfer from AT1G69120 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.008G098500.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY615964 | 0.0 | AY615964.1 Populus balsamifera subsp. trichocarpa APETALA1-like MADS-box PTAP1-1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002311353.2 | 1e-179 | truncated transcription factor CAULIFLOWER A isoform X1 | ||||
Swissprot | Q6E6S7 | 1e-136 | AP1_VITVI; Agamous-like MADS-box protein AP1 | ||||
TrEMBL | B9HIG9 | 1e-178 | B9HIG9_POPTR; Uncharacterized protein | ||||
STRING | cassava4.1_029935m | 1e-147 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF588 | 32 | 119 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 1e-119 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.008G098500.1 |
Entrez Gene | 7471072 |
Publications ? help Back to Top | |||
---|---|---|---|
|