PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.007G115200.6 | ||||||||
Common Name | POPTR_0007s03260g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 238aa MW: 26848.2 Da PI: 9.6294 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 85.2 | 3.9e-27 | 25 | 75 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n+ rqvtfskRr g++KKA+ELS+LCdae+a+++fs tgkl+eys+ Potri.007G115200.6 25 KKIDNTAARQVTFSKRRRGLFKKAYELSTLCDAEIALMVFSATGKLFEYSN 75 68***********************************************95 PP | |||||||
2 | K-box | 43.4 | 1.4e-15 | 113 | 187 | 25 | 99 |
K-box 25 kkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 kei + re+Rh+ GedL+ L+l+eLq+Le+ +e sl++ + K ++++i+ l+ k ++l een++L+++++ Potri.007G115200.6 113 IKEIAKKNRELRHMRGEDLQGLDLEELQKLEKIMEGSLRRLVEEKGGKIINEIDALKTKGEQLIEENQRLKQQVM 187 5666666799**************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-38 | 17 | 76 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.478 | 17 | 77 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.53E-29 | 18 | 90 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 19 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-27 | 19 | 39 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.12E-37 | 19 | 84 | No hit | No description |
Pfam | PF00319 | 6.5E-25 | 26 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-27 | 39 | 54 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-27 | 54 | 75 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.968 | 102 | 192 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 4.2E-13 | 111 | 186 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 238 aa Download sequence Send to blast |
MKGLLWGELK FFYLVKMTRK KIQIKKIDNT AARQVTFSKR RRGLFKKAYE LSTLCDAEIA 60 LMVFSATGKL FEYSNSSMGQ VIERRNLHPK NINTLDQPSL EKQLDGGVHA MLIKEIAKKN 120 RELRHMRGED LQGLDLEELQ KLEKIMEGSL RRLVEEKGGK IINEIDALKT KGEQLIEENQ 180 RLKQQVMSLL AGQGHLLEPG QSSDSLVTNI SSMGSVDPRQ DCDSSCAFLK LGLPFPD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-20 | 17 | 82 | 1 | 66 | MEF2C |
5f28_B | 3e-20 | 17 | 82 | 1 | 66 | MEF2C |
5f28_C | 3e-20 | 17 | 82 | 1 | 66 | MEF2C |
5f28_D | 3e-20 | 17 | 82 | 1 | 66 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed with highest levels in shoot tips and axillary buds. Also found in fully developed pedicels and flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.007G115200.6 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006380343.1 | 1e-174 | MADS-box protein JOINTLESS isoform X1 | ||||
Swissprot | Q9FUY6 | 1e-74 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | U5G411 | 1e-173 | U5G411_POPTR; Uncharacterized protein | ||||
STRING | cassava4.1_015454m | 7e-97 | (Manihot esculenta) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 2e-61 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.007G115200.6 |
Entrez Gene | 7486069 |
Publications ? help Back to Top | |||
---|---|---|---|
|