PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.007G115100.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 205aa MW: 23042.3 Da PI: 8.8277 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 83.9 | 9.5e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n+ rqvtfskRr g++KKA+ELS+LCdae+a+ +fs tgkl+eys+ Potri.007G115100.3 9 KKIDNTAARQVTFSKRRRGLFKKAYELSTLCDAEIALTVFSATGKLFEYSN 59 68***********************************************95 PP | |||||||
2 | K-box | 45 | 4.5e-16 | 73 | 146 | 26 | 99 |
K-box 26 keienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 kei + re+Rh+ GedL+ Lsl+eL+++e+ +e sl+++ + K+e ++ i+ l+ k ++l een++L+++++ Potri.007G115100.3 73 KEIAEKNRELRHMRGEDLQGLSLEELKKIEKLIEGSLRRVVEEKEEKSTKDINALKTKGEQLAEENQRLKQQVM 146 5555557999*************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.959 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.4E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.58E-26 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.66E-32 | 3 | 60 | No hit | No description |
PRINTS | PR00404 | 7.6E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.1E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.6E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.6E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.082 | 61 | 151 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.4E-13 | 70 | 145 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS50058 | 9.625 | 120 | 188 | IPR015898 | G-protein gamma-like domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007186 | Biological Process | G-protein coupled receptor signaling pathway | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005834 | Cellular Component | heterotrimeric G-protein complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0004871 | Molecular Function | signal transducer activity | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 205 aa Download sequence Send to blast |
MTRKKIQIKK IDNTAARQVT FSKRRRGLFK KAYELSTLCD AEIALTVFSA TGKLFEYSNT 60 RELDGGVHAM LIKEIAEKNR ELRHMRGEDL QGLSLEELKK IEKLIEGSLR RVVEEKEEKS 120 TKDINALKTK GEQLAEENQR LKQQVMNLSA AQGHLLEPGQ SPDSLVTNIS SMSSADPRQD 180 NDSSCAFLTL GLACYTHFHT NNLF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-19 | 1 | 60 | 1 | 60 | MEF2C |
5f28_B | 3e-19 | 1 | 60 | 1 | 60 | MEF2C |
5f28_C | 3e-19 | 1 | 60 | 1 | 60 | MEF2C |
5f28_D | 3e-19 | 1 | 60 | 1 | 60 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed with highest levels in shoot tips and axillary buds. Also found in fully developed pedicels and flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.007G115100.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF144739 | 9e-61 | EF144739.1 Populus trichocarpa clone WS01117_K02 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024461638.1 | 1e-130 | MADS-box protein JOINTLESS | ||||
Swissprot | Q9FUY6 | 5e-55 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | A0A2K1ZSW9 | 1e-129 | A0A2K1ZSW9_POPTR; Uncharacterized protein | ||||
STRING | EOX98675 | 6e-70 | (Theobroma cacao) | ||||
STRING | POPTR_0007s03280.1 | 2e-70 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G24540.1 | 1e-43 | AGAMOUS-like 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.007G115100.3 |
Publications ? help Back to Top | |||
---|---|---|---|
|