PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.007G115000.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 222aa MW: 25151.9 Da PI: 8.3211 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 84.9 | 4.9e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i++++ rqvtfskRr g++KKA+ELS+LCdae+a+++fs +gklyeys+ Potri.007G115000.3 9 KKIDDTIARQVTFSKRRGGLFKKAYELSTLCDAEIALMVFSASGKLYEYSN 59 689**********************************************95 PP | |||||||
2 | K-box | 36.6 | 1.9e-13 | 93 | 166 | 21 | 94 |
K-box 21 lakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 +a L+kei + re+ ++ GedL+ L+l+eL++Le+ +e+sl ++ + K e l+e+ ++l+++ +l+ ++ L Potri.007G115000.3 93 YATLNKEIAEKTRELSQVRGEDLQGLNLEELHKLEKLIETSLCRVVEEKGEQLVEENRRLRQQVMNLSAGQRHL 166 788999999999******************************************************99888877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.688 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.1E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.05E-28 | 2 | 70 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.42E-38 | 3 | 68 | No hit | No description |
PRINTS | PR00404 | 7.3E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.5E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.3E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.3E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.068 | 86 | 182 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 3.3E-8 | 93 | 167 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MTRRKIQIKK IDDTIARQVT FSKRRGGLFK KAYELSTLCD AEIALMVFSA SGKLYEYSNS 60 SMGQVIEKRN LHPKNIDMFG QPSLELQPDG AVYATLNKEI AEKTRELSQV RGEDLQGLNL 120 EELHKLEKLI ETSLCRVVEE KGEQLVEENR RLRQQVMNLS AGQRHLLEPD KSSDSLVTNT 180 RSMSSVDPFL TLGLACYTHF HANIFCFHSL VLTNIIYGTK Q* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 5e-20 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6byy_B | 5e-20 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6byy_C | 5e-20 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6byy_D | 5e-20 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6bz1_A | 5e-20 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6bz1_B | 5e-20 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6bz1_C | 5e-20 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6bz1_D | 5e-20 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed with highest levels in shoot tips and axillary buds. Also found in fully developed pedicels and flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.007G115000.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024461633.1 | 1e-160 | MADS-box protein JOINTLESS isoform X1 | ||||
Refseq | XP_024461634.1 | 1e-160 | MADS-box protein JOINTLESS isoform X1 | ||||
Refseq | XP_024461635.1 | 1e-160 | MADS-box protein JOINTLESS isoform X1 | ||||
Swissprot | Q9FUY6 | 8e-62 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | A0A2K1ZSY8 | 1e-159 | A0A2K1ZSY8_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0007s03300.1 | 5e-87 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 2e-51 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.007G115000.3 |
Publications ? help Back to Top | |||
---|---|---|---|
|