PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.006G277000.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 352aa MW: 39096.3 Da PI: 9.0155 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 180.1 | 5.6e-56 | 28 | 155 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lppGfrFhPtdeel+++yL+ k+++ ++++ ++i +vd++k+ePwdLp k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke Potri.006G277000.1 28 LPPGFRFHPTDEELITYYLQSKISDADFSC-RAIGDVDLNKCEPWDLPGKAKMGEKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKE 117 79****************************.89***************99999************************************** PP NAM 92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++++ +++lvg+kktLvfy+grap+gekt+Wvmheyr+ Potri.006G277000.1 118 IFNSvTSQLVGMKKTLVFYRGRAPRGEKTNWVMHEYRF 155 **9989999***************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.27E-64 | 26 | 176 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 60.503 | 28 | 176 | IPR003441 | NAC domain |
Pfam | PF02365 | 9.2E-29 | 29 | 154 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 352 aa Download sequence Send to blast |
MQKPTSDKGK KQVEKEKDME GDAKDETLPP GFRFHPTDEE LITYYLQSKI SDADFSCRAI 60 GDVDLNKCEP WDLPGKAKMG EKEWYFFSLR DRKYPTGVRT NRATNTGYWK TTGKDKEIFN 120 SVTSQLVGMK KTLVFYRGRA PRGEKTNWVM HEYRFHSKAA FRASKDEWVV CRVFQKSAGV 180 KKYPSNQSRA ANPYNLEIGP SVIPSQMMQA AENIQLPIGR NYMMSNAELQ AELTRVFRAG 240 GSTGINLPMQ SPLNNTYSVG GGGPGGGGCF TISGLNLNLG GAASQPMLRP MAPPVMNQQD 300 VINSSMMTSS NSFALDQAAA YGAEMNTANG HANRFMGMEQ CMDLENYWPP Y* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-56 | 27 | 182 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-56 | 27 | 182 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-56 | 27 | 182 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-56 | 27 | 182 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-56 | 27 | 182 | 19 | 174 | NAC domain-containing protein 19 |
3swm_B | 1e-56 | 27 | 182 | 19 | 174 | NAC domain-containing protein 19 |
3swm_C | 1e-56 | 27 | 182 | 19 | 174 | NAC domain-containing protein 19 |
3swm_D | 1e-56 | 27 | 182 | 19 | 174 | NAC domain-containing protein 19 |
3swp_A | 1e-56 | 27 | 182 | 19 | 174 | NAC domain-containing protein 19 |
3swp_B | 1e-56 | 27 | 182 | 19 | 174 | NAC domain-containing protein 19 |
3swp_C | 1e-56 | 27 | 182 | 19 | 174 | NAC domain-containing protein 19 |
3swp_D | 1e-56 | 27 | 182 | 19 | 174 | NAC domain-containing protein 19 |
4dul_A | 1e-56 | 27 | 182 | 16 | 171 | NAC domain-containing protein 19 |
4dul_B | 1e-56 | 27 | 182 | 16 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First expressed in early to mid-globular-stage embryos. In late globular stage, detected as a stripe running medially across the top of the embryo. In heart stage embryo, expression is restricted to a stripe between the cotyledon primordia, but confined to hypodermal cells. In the bending-cotyledon stage, localized in a region surrounding the SAM, that correspond to the boundary region of cotyledon margins (BCM) and the boundaries between SAM and cotyledons, including protoderm cells. Observed in the margins of leaf primordia, and later restricted to the leaf sinus region, with a diminution in outgrowing teeth. Restricted to the proximal part of mature leaves. Expressed at the boundaries between the inflorescence meristem (IM) and flower primordia. Once the flower starts to grow out and the internode begin to elongates, restricted to the axils of the floral pedicels through several nodes. Detected within floral primordia, between sepal primordia and the floral meristem. Also present at the boundaries of individual sepal primordia, as well as in the region surrounding each petal and stamen primordium. Later detected transiently at the boundaries between locules of each theca in anthers. Expression at the inner part of presumtive septal regions that raises to include presumptive placenta, at the tips of septal primordia, as septum grow. Localized in the fused region of the septum. Found at the boundaries of ovule primordia, and later at the boundary between the nucellus and the chalaza. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:17251269}. | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in buds and flowers, and, to a lower extent, in the aerial parts of seedling, inflorescence and old silique. In a general manner, present at the boundaries between mersitems and araising primordia. {ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:15053771, ECO:0000269|PubMed:9212461}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.006G277000.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By BRM and SYD, at the chromatin level, and conferring a very specific spatial expression pattern. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024459217.1 | 0.0 | NAC domain-containing protein 100 isoform X1 | ||||
Swissprot | O04017 | 5e-82 | NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2 | ||||
TrEMBL | A0A2K2A9B1 | 0.0 | A0A2K2A9B1_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0006s29180.1 | 0.0 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5073 | 32 | 53 | Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G24430.2 | 1e-118 | NAC domain containing protein 38 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.006G277000.1 |