PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.005G140600.1 | ||||||||
Common Name | POPTR_0005s18395g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 41aa MW: 4790.36 Da PI: 10.1241 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 39.6 | 1.9e-12 | 8 | 40 | 5 | 37 |
TCP 5 kdrhskihTkvggRdRRvRlsaecaarfFdLqd 37 + h ++hTkv+g +RR+R++ +caa +F+ +d Potri.005G140600.1 8 TLIHQDRHTKVEGHGRRIRIPTTCAAGIFQFTD 40 5669***************************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51369 | 9.627 | 11 | 41 | IPR017887 | Transcription factor TCP subgroup |
Pfam | PF03634 | 1.6E-8 | 12 | 41 | IPR005333 | Transcription factor, TCP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 41 aa Download sequence Send to blast |
HYDNNNKTLI HQDRHTKVEG HGRRIRIPTT CAAGIFQFTD K |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.005G140600.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | A0A2K2AGK4 | 2e-22 | A0A2K2AGK4_POPTR; Uncharacterized protein (Fragment) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45680.1 | 6e-12 | TCP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.005G140600.1 |
Entrez Gene | 18099551 |