PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.005G091100.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 263aa MW: 30564.9 Da PI: 8.6623 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 79.1 | 3e-25 | 16 | 65 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien++ rqvtfskRr+ +lKK +ELSvLCda++ +iifsstgkl y+s Potri.005G091100.1 16 RIENQTTRQVTFSKRRAVLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCS 65 8***********************************************96 PP | |||||||
2 | K-box | 69.3 | 1.3e-23 | 89 | 176 | 12 | 99 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 e+l+ ela L+ke + L ++ R + Ged++s+ ++eL +eq+Le++++k+R +Knell++q+e+l++ke++l+een ++ + ++ Potri.005G091100.1 89 DRREQLYGELAMLRKESRRLHSNMRCYTGEDMSSIPYEELDAVEQELERAVNKVRHRKNELLHQQLENLRRKERMLEEENSNMYRWIQ 176 55688999************************************************************************99987766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 7.1E-30 | 7 | 66 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 25.483 | 7 | 67 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-23 | 9 | 29 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.03E-27 | 11 | 84 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.26E-35 | 11 | 82 | No hit | No description |
Pfam | PF00319 | 6.7E-22 | 16 | 63 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-23 | 29 | 44 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-23 | 44 | 65 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 4.3E-22 | 88 | 175 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.405 | 91 | 181 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 263 aa Download sequence Send to blast |
MHEVHFGSFA KIAIRRIENQ TTRQVTFSKR RAVLLKKTHE LSVLCDAQIG LIIFSSTGKL 60 CQYCSEGLRM EQIIERYQRM TGTCIPDHDR REQLYGELAM LRKESRRLHS NMRCYTGEDM 120 SSIPYEELDA VEQELERAVN KVRHRKNELL HQQLENLRRK ERMLEEENSN MYRWIQEHRA 180 ALGYQQAAIE ANPVEHQQVL DQFQFCGERP VACFSFQTSL IKLTHTISSL LSPAFKALAS 240 TTEVSKELVR QTKKLQGSSV YN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-15 | 11 | 77 | 5 | 69 | MEF2C |
5f28_B | 4e-15 | 11 | 77 | 5 | 69 | MEF2C |
5f28_C | 4e-15 | 11 | 77 | 5 | 69 | MEF2C |
5f28_D | 4e-15 | 11 | 77 | 5 | 69 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during seed development. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in buds, flowers and immature seeds, but not in roots, stems, leaves, seedlings or siliques valves. Expression in seed coat is confined to the endothelium layer. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation (PubMed:12368498, PubMed:16080001). Necessary for the normal activation of the BANYULS promoter in the endothelium body (PubMed:12368498). Is required, together with AGL11/STK for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). Interacts genetically with AGL1/SHP1 and AGL5/SHP2 in a partially antagonistic manner and represses AGL1/SHP1, AGL5/SHP2, and AGL8/FUL during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). Mediates the crosstalk between endothelium and nucellus to ensure proper seed formation. Functions redundantly with AGL63/GOA to repress nucellus growth and promote its degeneration. Represses the negative regulator of autophagy and programmed cell death HVA22D in the proximal nucellus (PubMed:27233529). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:12368498, ECO:0000269|PubMed:16080001, ECO:0000269|PubMed:22176531, ECO:0000269|PubMed:27233529, ECO:0000269|PubMed:27776173}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.005G091100.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC216682 | 3e-67 | AC216682.1 Populus trichocarpa clone POP024-L07, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011022027.1 | 1e-137 | PREDICTED: protein TRANSPARENT TESTA 16-like isoform X1 | ||||
Refseq | XP_011022028.1 | 1e-137 | PREDICTED: protein TRANSPARENT TESTA 16-like isoform X1 | ||||
Swissprot | Q8RYD9 | 5e-77 | TT16_ARATH; Protein TRANSPARENT TESTA 16 | ||||
TrEMBL | A0A2K2ADY7 | 0.0 | A0A2K2ADY7_POPTR; Uncharacterized protein | ||||
STRING | EOX99096 | 1e-116 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4935 | 29 | 52 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.2 | 2e-79 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.005G091100.1 |