PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.004G046700.1 | ||||||||
Common Name | POPTR_0004s04630g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 149aa MW: 16467 Da PI: 7.773 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 134.8 | 2.7e-42 | 64 | 140 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cqv++C++d+++ak+yh+rhkvCe+h+ka++vlv+g+eqrfCqqCsrfh+lsefD++krsCrrrLa+hnerrrk+++ Potri.004G046700.1 64 CQVKNCTTDMTDAKRYHKRHKVCEFHAKASSVLVNGVEQRFCQQCSRFHDLSEFDDSKRSCRRRLAGHNERRRKSSS 140 **************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 1.2E-56 | 1 | 148 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 9.7E-34 | 57 | 125 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.077 | 61 | 138 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 5.49E-39 | 62 | 141 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 7.8E-33 | 64 | 137 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010229 | Biological Process | inflorescence development | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
MGTSKAEGKR NLKEIEDEEE DDDEEDIYTG LGFGDDDKIK KKGRTGSGCG GGGGRSSSSP 60 PISCQVKNCT TDMTDAKRYH KRHKVCEFHA KASSVLVNGV EQRFCQQCSR FHDLSEFDDS 120 KRSCRRRLAG HNERRRKSSS DNQGEGSN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 5e-39 | 54 | 137 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00290 | DAP | Transfer from AT2G33810 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.004G046700.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002305783.2 | 1e-104 | squamosa promoter-binding-like protein 3 isoform X1 | ||||
Swissprot | Q38741 | 6e-49 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | B9H2S4 | 1e-103 | B9H2S4_POPTR; Squamosa promoter-binding-like protein | ||||
STRING | POPTR_0004s04630.1 | 1e-104 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 | Representative plant | OGRP97 | 17 | 230 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 2e-42 | squamosa promoter binding protein-like 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.004G046700.1 |
Entrez Gene | 7456784 |
Publications ? help Back to Top | |||
---|---|---|---|
|