PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.003G169100.1 | ||||||||
Common Name | POPTR_0003s16750g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 158aa MW: 17992.4 Da PI: 10.0522 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.7 | 1e-32 | 80 | 138 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+ Potri.003G169100.1 80 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHQ 138 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.2E-33 | 65 | 138 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.57E-29 | 72 | 139 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.585 | 75 | 140 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.0E-38 | 80 | 139 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.7E-26 | 81 | 138 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
GO:0010055 | Biological Process | atrichoblast differentiation | ||||
GO:0032107 | Biological Process | regulation of response to nutrient levels | ||||
GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MSLNMINSYA STDFEGTRGN GLLGLMQEMQ APASLNFDDI SQNRGFVGSG IEGKLGKNKG 60 EKKIRKPKYA FQTRSRVDIL DDGYRWRKYG QKAVKNNKFP RSYYRCTHQG CNVKKQVQRL 120 TKDEGVVVTT YEGMHSHQIE KSPDNFEHIL SQMQIYS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-28 | 70 | 139 | 7 | 76 | Probable WRKY transcription factor 4 |
2lex_A | 2e-28 | 70 | 139 | 7 | 76 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.003G169100.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | GQ377438 | 0.0 | GQ377438.1 (Populus tomentosa x P. bolleana) x P. tomentosa WRKY transcription factor 18 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002304741.2 | 1e-116 | probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 9e-54 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | B9GVW0 | 1e-115 | B9GVW0_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0003s16750.1 | 1e-115 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1156 | 34 | 110 | Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 9e-56 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.003G169100.1 |
Entrez Gene | 7493246 |