PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G119700.6
Common NamePOPTR_0003s11960g
Organism
Populus trichocarpa
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 115aa    MW: 13068.2 Da    PI: 10.8756
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G119700.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.23.4e-31959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fss+gklye+ss
  Potri.003G119700.6  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSSRGKLYEFSS 59
                        79***********************************************96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.142161IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-33372IPR002100Transcription factor, MADS-box
CDDcd002652.36E-42371No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-32323IPR002100Transcription factor, MADS-box
PfamPF003194.1E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSS RGKLYEFSSS  60
SINRTIERYQ KRAKDVGISS KMVQDNIQPV KEDTFTLAKK IELLEVSKRF QGSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-20169169MEF2C
5f28_B4e-20169169MEF2C
5f28_C4e-20169169MEF2C
5f28_D4e-20169169MEF2C
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During floral transition, expressed very early at the flanks of the inflorescence meristem in the anlagens upon the transition to flowering Subsequently, expression levels increase in the first and second stages of the floral meristem and at stage 3, expression is restricted to the L1 and L2 layers. Later on, expressed in the gynoecium and stamen primordia at stage 6. {ECO:0000269|PubMed:25636918}.
UniprotTISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). Expressed in lateral root cap, root epidermis, root endodermis, columella of the root meristematic region, the vascular cylinder in differentiated zones of the primary root and in emerged lateral root primordia (PubMed:24121311). Expressed in pollen (PubMed:12949148). {ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:24121311, ECO:0000269|PubMed:7549482}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G119700.6
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:24121311}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ5008801e-126DQ500880.1 Populus tomentosa MADS box transcription factor (MADS3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024452474.16e-72agamous-like MADS-box protein AGL19 isoform X1
RefseqXP_024452475.16e-72agamous-like MADS-box protein AGL19 isoform X1
RefseqXP_024452478.14e-72agamous-like MADS-box protein AGL19 isoform X3
SwissprotQ388384e-50AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBLB9GW461e-70B9GW46_POPTR; Uncharacterized protein
STRINGcassava4.1_026051m3e-59(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.12e-52AGAMOUS-like 14
Publications ? help Back to Top
  1. Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W
    GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox.
    Plant Physiol., 2004. 136(1): p. 2621-32
    [PMID:15375207]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Qu Y, et al.
    Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis.
    J. Exp. Bot., 2017. 68(17): p. 4851-4867
    [PMID:28992128]