PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.003G079100.1 | ||||||||
Common Name | POPTR_0003s07680g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 181aa MW: 20520.2 Da PI: 8.6426 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60.9 | 2.7e-19 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +l+++v+ +G ++Wkt+a + g++R++k+c++rw +yl Potri.003G079100.1 18 KGAWTAEEDNKLAHCVEVHGAKRWKTVALKSGLNRCGKSCRLRWMNYL 65 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 48.9 | 1.5e-15 | 71 | 116 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Potri.003G079100.1 71 RGNISCDEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 116 5677779***************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.541 | 13 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 6.7E-15 | 17 | 67 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 9.9E-30 | 17 | 112 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.0E-17 | 18 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.4E-23 | 19 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.23E-11 | 20 | 65 | No hit | No description |
PROSITE profile | PS51294 | 24.92 | 66 | 120 | IPR017930 | Myb domain |
SMART | SM00717 | 7.7E-14 | 70 | 118 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.0E-14 | 71 | 116 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.3E-25 | 73 | 120 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.02E-10 | 77 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009957 | Biological Process | epidermal cell fate specification | ||||
GO:0010090 | Biological Process | trichome morphogenesis | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MAPKNTVTDA STKKVMSKGA WTAEEDNKLA HCVEVHGAKR WKTVALKSGL NRCGKSCRLR 60 WMNYLRPNIK RGNISCDEED LIIRLHKLLG NRWSLIAGRL PGRTDNEIKN YWNSHLSKKI 120 IDQTQKEKMP DQPSTPLATM HQKTSDAIQV EEEGSAREAW NLETGNFDVD EFFDFSAEGF 180 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-28 | 16 | 120 | 5 | 108 | B-MYB |
1mse_C | 3e-28 | 15 | 120 | 1 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 3e-28 | 15 | 120 | 1 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Siliques. {ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. | |||||
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.003G079100.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002304289.1 | 1e-134 | transcription factor MYB114 | ||||
Swissprot | P10290 | 2e-51 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
Swissprot | Q38850 | 1e-51 | MYB5_ARATH; Transcription repressor MYB5 | ||||
TrEMBL | B9GYD5 | 1e-133 | B9GYD5_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0003s07680.1 | 1e-133 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2148 | 32 | 88 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13540.1 | 5e-54 | myb domain protein 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.003G079100.1 |
Entrez Gene | 7461986 |