PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.002G109700.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 81aa MW: 9096.71 Da PI: 10.6319 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 88.8 | 2.8e-28 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRrng+lKKA+EL +LCdaev v+ifsstgkly++ss Potri.002G109700.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVMIFSSTGKLYDFSS 59 8***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.8E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.328 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.95E-37 | 2 | 60 | No hit | No description |
SuperFamily | SSF55455 | 2.35E-28 | 2 | 63 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 81 aa Download sequence Send to blast |
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVMIFSS TGKLYDFSST 60 RSDFKISLIY IYIYLLTLQG * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-18 | 1 | 70 | 1 | 69 | MEF2C |
5f28_B | 1e-18 | 1 | 70 | 1 | 69 | MEF2C |
5f28_C | 1e-18 | 1 | 70 | 1 | 69 | MEF2C |
5f28_D | 1e-18 | 1 | 70 | 1 | 69 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:14701936}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.002G109700.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_026433220.1 | 4e-36 | MADS-box transcription factor 23-like isoform X3 | ||||
Swissprot | Q6EP49 | 3e-33 | MAD27_ORYSJ; MADS-box transcription factor 27 | ||||
TrEMBL | A0A438G0F5 | 1e-36 | A0A438G0F5_VITVI; MADS-box transcription factor ANR1 | ||||
STRING | POPTR_0001s29100.1 | 3e-37 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57230.1 | 2e-35 | AGAMOUS-like 16 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.002G109700.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|