PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.002G105600.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 226aa MW: 25159.8 Da PI: 7.5072 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.9 | 6.2e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKAeELSvLCdaevaviifs tgkl+eyss Potri.002G105600.1 9 KKIDNVTARQVTFSKRRRGLFKKAEELSVLCDAEVAVIIFSATGKLFEYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 53.9 | 7.6e-19 | 87 | 171 | 15 | 99 |
K-box 15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + + ++ +L ke+++ +++R++ GedL+ L+++eLqqLe++Le +l+++ ++K e ++++i++l +k +l eenk+L++k++ Potri.002G105600.1 87 QLENSNHMRLSKEVSEKSHQLRRMRGEDLHGLNIEELQQLEKALEVGLSRVLETKGERIMNEISTLERKGVQLLEENKQLKQKIA 171 556677889999999999*****************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 9.7E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.039 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.34E-39 | 2 | 75 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.35E-31 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.3E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.8E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.3E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.3E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.601 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 9.5E-17 | 90 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 226 aa Download sequence Send to blast |
MAREKIKIKK IDNVTARQVT FSKRRRGLFK KAEELSVLCD AEVAVIIFSA TGKLFEYSSS 60 SMKDVLARYN LHSNNLDKIN PPSLELQLEN SNHMRLSKEV SEKSHQLRRM RGEDLHGLNI 120 EELQQLEKAL EVGLSRVLET KGERIMNEIS TLERKGVQLL EENKQLKQKI ATIYKGKGPA 180 LVDLDTAVQE EGMSSESTTN VCSCSSGPPV EDDSSDTSLK LGLAI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed with highest levels in shoot tips and axillary buds. Also found in fully developed pedicels and flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.002G105600.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY501392 | 0.0 | AY501392.1 Populus tomentosa MADS box transcription factor (MADS1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024452024.1 | 1e-163 | MADS-box protein JOINTLESS | ||||
Swissprot | Q9FUY6 | 1e-101 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | A0A2K2BGT0 | 1e-162 | A0A2K2BGT0_POPTR; Uncharacterized protein | ||||
STRING | EOY15444 | 1e-132 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF890 | 33 | 106 | Representative plant | OGRP6076 | 11 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-100 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.002G105600.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|