PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.002G079000.1 | ||||||||
Common Name | POPTR_0002s07920g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 212aa MW: 24669.2 Da PI: 7.733 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.2 | 9.2e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien+snrqvt+skRr gi+KKA+E+ vLCda+v+++if+s+g+++ey+s Potri.002G079000.1 9 KRIENSSNRQVTYSKRRSGIIKKAKEITVLCDAQVSLVIFASSGRMHEYCS 59 79***********************************************96 PP | |||||||
2 | K-box | 70.5 | 5.3e-24 | 71 | 169 | 1 | 99 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 y+k+sgk+l++ak+e+l++e++++kke+e++q e+Rhl+G+d++sL +keL+ +e++L+++l +R+k++e+ + ++ + +e ++ + Potri.002G079000.1 71 YHKQSGKRLWDAKHENLSNEIDRIKKENESMQIELRHLKGQDISSLPHKELMAIEEALDTGLAAVRKKQMEFHSMLEQNEKILDEEFKHLQ 161 8999*******************************************************************99999999999999999999 PP K-box 92 kaLrkkle 99 L+++ + Potri.002G079000.1 162 FVLQQQEM 169 99998865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.1E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.057 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.09E-40 | 2 | 80 | No hit | No description |
SuperFamily | SSF55455 | 5.89E-35 | 2 | 96 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.4E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.8E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.4E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.4E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.8E-16 | 82 | 162 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.193 | 84 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 212 aa Download sequence Send to blast |
MGRGKIEIKR IENSSNRQVT YSKRRSGIIK KAKEITVLCD AQVSLVIFAS SGRMHEYCSP 60 STTVVDLLDK YHKQSGKRLW DAKHENLSNE IDRIKKENES MQIELRHLKG QDISSLPHKE 120 LMAIEEALDT GLAAVRKKQM EFHSMLEQNE KILDEEFKHL QFVLQQQEMA MEENAMEMEN 180 AYHQQRVRDY NSQVPLAFRV QPIQPNLQER M* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 1e-16 | 1 | 91 | 1 | 83 | MEF2 CHIMERA |
6bz1_B | 1e-16 | 1 | 91 | 1 | 83 | MEF2 CHIMERA |
6bz1_C | 1e-16 | 1 | 91 | 1 | 83 | MEF2 CHIMERA |
6bz1_D | 1e-16 | 1 | 91 | 1 | 83 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pth.12432 | 0.0 | bud |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed during flower development in stamens and petals. {ECO:0000269|PubMed:17920788, ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may play role in specifying stamen and petal organ identity. {ECO:0000269|PubMed:23181568, ECO:0000269|Ref.1, ECO:0000305|PubMed:17920788}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.002G079000.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU029172 | 0.0 | EU029172.1 Populus deltoides MADS box transcription factor (PI) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002300964.1 | 1e-157 | floral homeotic protein PMADS 2 | ||||
Swissprot | Q0HA25 | 1e-123 | MADS9_VITVI; Agamous-like MADS-box protein MADS9 | ||||
TrEMBL | B9GU03 | 1e-155 | B9GU03_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0002s07920.1 | 1e-156 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4355 | 32 | 55 | Representative plant | OGRP5302 | 12 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G20240.1 | 1e-81 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.002G079000.1 |
Entrez Gene | 7466443 |
Publications ? help Back to Top | |||
---|---|---|---|
|