PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.001G372100.4 | ||||||||
Common Name | POPTR_0001s38100g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 161aa MW: 17622.7 Da PI: 5.9852 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 49.7 | 1.2e-15 | 125 | 159 | 1 | 36 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrk 36 +ep++VNaKQy++Il+RRq+Rak+e+e+k +ksrk Potri.001G372100.4 125 EEPVFVNAKQYHGILRRRQSRAKAESESKA-IKSRK 159 69***************************9.88887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 0.0013 | 123 | 160 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 20.47 | 124 | 160 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 3.1E-11 | 126 | 159 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 129 | 149 | IPR018362 | CCAAT-binding factor, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MRFEFGDSVC ITAMTSSLHD LSDNSEADEQ QNESEPQIQS SSPAMAQAHP GFSTPNVQYA 60 TPQLGAGHAM APATYPYPDP YYRSIFAPYD PQPYPPQPYG AQPMVHLQLM GIQQAGVPLP 120 SDAVEEPVFV NAKQYHGILR RRQSRAKAES ESKAIKSRKV * |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pth.12256 | 0.0 | bud |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.001G372100.4 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC182693 | 1e-74 | AC182693.2 Populus trichocarpa clone Pop1-44N6, complete sequence. | |||
GenBank | AC187864 | 1e-74 | AC187864.2 Populus trichocarpa clone Pop1-32E3, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024448163.1 | 1e-114 | nuclear transcription factor Y subunit A-7 isoform X2 | ||||
Swissprot | Q84JP1 | 1e-48 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A2K2C9T0 | 1e-113 | A0A2K2C9T0_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0001s38100.1 | 1e-99 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 2e-33 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.001G372100.4 |
Entrez Gene | 7487567 |
Publications ? help Back to Top | |||
---|---|---|---|
|