PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G241700.1
Common NamePOPTR_0001s24850g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 758aa    MW: 85387.9 Da    PI: 4.89
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G241700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS367.32.1e-1123847541373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL+ cA+avss+d ++a++lL+++++++sp gd  qRla +f+++L+arla++++++y al++++ s    ++ l+a+++++ ++P+ 
  Potri.001G241700.1 384 LRTLLVLCAQAVSSNDRRAANELLKQIRQHSSPLGDGSQRLANCFANGLEARLAGTGTQIYTALSTEKWS---AVDMLKAYQAYVSACPFK 471
                         5789***********************************************************9999998...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         k++ + aN+ I++ +e+++++HiiDf+i +G+QWp+L+  L+ Rp+gpp lRiTg++ p+sg   +e+++etg+rL k++e+ +vpfe+n+
  Potri.001G241700.1 472 KMAIIFANHNIMKVAEKASTLHIIDFGILYGFQWPPLIYRLSRRPGGPPILRITGIELPQSGfrPAERVQETGRRLVKYCERYNVPFEYNP 562
                         *************************************************************9***************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +a++++++++++L+++++E+laVn+ ++ ++llde+v ++s+r++vL+l+ +++P++++++  + ++n++ F++rf e+l ++salfd+l
  Potri.001G241700.1 563 -IAQKWDTIQIDDLKINHDEVLAVNCLFRFKNLLDETVVVNSPRNAVLNLISKTKPDIFIHAIVNGSYNAPFFVTRFRETLFHFSALFDML 652
                         .7***************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         ++++pre+e r k E+e+ gre++nv+aceg+er+er et+++W+ r ++aG+k++pl+ ++ k  k+ ++  + + ++v+ + +++ +gW
  Potri.001G241700.1 653 DSNMPREDEMRLKFEKEFYGREVMNVIACEGSERVERPETYKQWQVRNMRAGLKQLPLDPHVIKYLKCKVKVRYHEDFEVDGDGHWMRQGW 743
                         ***********************************************************************999899************** PP

                GRAS 363 kdrpLvsvSaW 373
                         k+r++++ SaW
  Potri.001G241700.1 744 KGRTIIASSAW 754
                         *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.911358735IPR005202Transcription factor GRAS
PfamPF035147.3E-110384754IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 758 aa     Download sequence    Send to blast
MGSDSRFTEF PGSNKFEDEI VFPDSNQYHN VSNGFKFEDL DFDCVENPLV LPDPDPGALS  60
SITAIDEDSP SDDNDSENLL KYINQMLMEE DMEEKPCMFH DPLALQAAER SLYDILGEKN  120
QPSLPHDSPS YGDQFLVDSP DDVFWSSRSD YSSNKSSFSN SVSSVDPQGN GEFGEFKPLF  180
MQTPLPNNFV FHSAANFSSE SSFKLHNGLA SNGDSATKPS AGNIVAPNLF SDSDLALQFK  240
RGVEEASKFL PKGNPLIIDL ETSALAPEMN RDAPEVAVKA EKEDREFFPE WLTGKKNHER  300
EDEDFEEERS NKQSAVHVDE SELSEMFDML VGVGEGCRPP GCILDQAEQC ESSKTVRQNG  360
QTKGSSGSKT RAKIQGNNKE VVDLRTLLVL CAQAVSSNDR RAANELLKQI RQHSSPLGDG  420
SQRLANCFAN GLEARLAGTG TQIYTALSTE KWSAVDMLKA YQAYVSACPF KKMAIIFANH  480
NIMKVAEKAS TLHIIDFGIL YGFQWPPLIY RLSRRPGGPP ILRITGIELP QSGFRPAERV  540
QETGRRLVKY CERYNVPFEY NPIAQKWDTI QIDDLKINHD EVLAVNCLFR FKNLLDETVV  600
VNSPRNAVLN LISKTKPDIF IHAIVNGSYN APFFVTRFRE TLFHFSALFD MLDSNMPRED  660
EMRLKFEKEF YGREVMNVIA CEGSERVERP ETYKQWQVRN MRAGLKQLPL DPHVIKYLKC  720
KVKVRYHEDF EVDGDGHWMR QGWKGRTIIA SSAWIPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A8e-523677561379Protein SCARECROW
5b3h_D8e-523677561379Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.68710.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G241700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2089320.0AC208932.1 Populus trichocarpa clone JGIACSB1081-D10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299867.10.0scarecrow-like protein 14
RefseqXP_024449614.10.0scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLB9GJM10.0B9GJM1_POPTR; Uncharacterized protein
STRINGPOPTR_0001s24850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]