PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.001G169600.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 154aa MW: 18080.4 Da PI: 6.7842 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.4 | 2.4e-16 | 30 | 75 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Potri.001G169600.2 30 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 75 78999*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 4.298 | 1 | 24 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 8.5E-12 | 10 | 36 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.37E-21 | 10 | 84 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.672 | 25 | 79 | IPR017930 | Myb domain |
SMART | SM00717 | 1.9E-15 | 29 | 77 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-14 | 30 | 75 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.37E-10 | 34 | 75 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-21 | 37 | 75 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MEDNRIQTLN RCGKSCRLRW LNYLRPNIKR GNISDQEEDL ILRLHKLLGN RWSLIAGRLP 60 GRTDNEIKNY WNSHLSKKIN KKGKQIEASN RECQKIEKKT VEISLELKED NKPHNGSEEG 120 SNVNFNIDDL FDFTDEDTLN MEWMSRFLEM DEA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-20 | 10 | 80 | 39 | 109 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First expressed in leaf primordia. Later confined to developing trichome cells where it persists at high levels throughout all stages of trichome development. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15728674}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, seed coats, leaves, stems and flowers. Detected specifically in trichomes, and in the cell division and differentiation zone of the root. {ECO:0000269|PubMed:11437443}. | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:16207757}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.001G169600.2 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | GU272916 | 7e-67 | GU272916.1 Populus balsamifera isolate HAY07 haplotype A myb family transcription factor gene, partial sequence. | |||
GenBank | GU272917 | 7e-67 | GU272917.1 Populus balsamifera isolate HAY07 haplotype B myb family transcription factor gene, partial sequence. | |||
GenBank | GU272921 | 7e-67 | GU272921.1 Populus balsamifera isolate KUU07 haplotype B myb family transcription factor gene, partial sequence. | |||
GenBank | GU272927 | 7e-67 | GU272927.1 Populus balsamifera isolate NWL07 haplotype B myb family transcription factor gene, partial sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002298097.1 | 1e-103 | transcription factor MYB114 | ||||
Swissprot | Q96276 | 7e-40 | MYB23_ARATH; Transcription factor MYB23 | ||||
Swissprot | Q9SEI0 | 4e-40 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | B9GKV1 | 1e-102 | B9GKV1_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0001s16970.1 | 1e-103 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 2e-42 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.001G169600.2 |