PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pta013179 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 90aa MW: 9870.72 Da PI: 10.4384 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 122.9 | 1.1e-38 | 26 | 90 | 6 | 70 |
S1FA 6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 + kG+nPGlivllvv g+ll+f+vgny+ly+yaqk+lP +kkkPvskkk+kreklkqG+++PGe Pta013179 26 TAGKGFNPGLIVLLVVVGVLLIFIVGNYVLYMYAQKTLPAKKKKPVSKKKMKREKLKQGISAPGE 90 456*************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 8.9E-38 | 27 | 90 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MDEDFSSQAD VDPSAFASQE RLLTKTAGKG FNPGLIVLLV VVGVLLIFIV GNYVLYMYAQ 60 KTLPAKKKKP VSKKKMKREK LKQGISAPGE |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pta.918 | 1e-152 | root| shoot| xylem |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010104121.2 | 3e-25 | DNA-binding protein S1FA | ||||
Refseq | XP_024026346.1 | 3e-25 | DNA-binding protein S1FA | ||||
Swissprot | P42553 | 2e-15 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
TrEMBL | W9SCA3 | 7e-23 | W9SCA3_9ROSA; DNA-binding protein S1FA1 | ||||
STRING | XP_010104121.1 | 1e-23 | (Morus notabilis) |