PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pta013132 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 98aa MW: 11100 Da PI: 4.8337 | ||||||||
Description | BBR-BPC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 47.2 | 8.5e-15 | 20 | 92 | 17 | 89 |
GAGA_bind 17 aaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllven 89 ++ lk+ l+l+s +erda irer+ a++ekk a+ae+ a++qrd+a+a+r++a++erd +++al+ +++ Pta013132 20 EKCLKDYAMLRLISAKTERDAVIRERDKAIAEKKIALAEKXAAYAQRDAAFAQRDEAIMERDAAFAALENAKD 92 367999999**********************************************************998765 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MDDEDRKGVH PALNDEPLDE KCLKDYAMLR LISAKTERDA VIRERDKAIA EKKIALAEKX 60 AAYAQRDAAF AQRDEAIMER DAAFAALENA KDERNRGX |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pta.8173 | 1e-165 | xylem |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020522700.1 | 4e-20 | barley B recombinant-like protein D isoform X1 | ||||
Swissprot | Q5VSA8 | 1e-15 | BBRD_ORYSJ; Barley B recombinant-like protein D | ||||
TrEMBL | A0A2D1VJG0 | 9e-59 | A0A2D1VJG0_PINSY; Uncharacterized protein (Fragment) | ||||
TrEMBL | A0A2D1VJJ0 | 9e-59 | A0A2D1VJJ0_PINPS; Uncharacterized protein (Fragment) | ||||
TrEMBL | K7P2W7 | 9e-59 | K7P2W7_PINMU; Uncharacterized protein (Fragment) | ||||
STRING | ERN05777 | 3e-19 | (Amborella trichopoda) |
Publications ? help Back to Top | |||
---|---|---|---|
|