PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pta011846

Organism

Pinus taeda

Taxonomic ID

3352

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus

Family

MIKC_MADS

Protein Properties

Length: 180aa MW: 20838.9 Da PI: 9.72

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Pta#S20491775	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	101.9	2.4e-32	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtfskRrng+lKKA+ELSvLCdaevaviifs++gklye++ Pta011846 9 KRIENTTNRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSNRGKLYEFA 58 79***********************************************8 PP
2	K-box	66.9	6.9e-23	78	161	9	94
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 +e+ ++++++ ++L++ei+ L + +R+l+G++L+ LslkeL Le +++++++++Rs+K+++ll q + l++k e q en + Pta011846 78 RWET--STSSKNCENLRQEIDILTKVNRNLMGDNLSALSLKELDLLEARIQRGIQSVRSRKEQILLVQNDFLRNKIAECQCENASV 161 4555..6789999******************************************************************9999865 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.0E-43	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	34.356	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.83E-34	2	79	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.24E-45	2	76	No hit	No description
PRINTS	PR00404	2.4E-33	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.3E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.4E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.4E-33	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	10.934	81	172	IPR002487	Transcription factor, K-box
Pfam	PF01486	1.8E-16	84	160	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 180 aa Download sequence Send to blast
MGRGKIEIKR IENTTNRQVT FSKRRNGLLK KAYELSVLCD AEVAVIIFSN RGKLYEFANK 60 SVNRTIERYK KVCAKDMRWE TSTSSKNCEN LRQEIDILTK VNRNLMGDNL SALSLKELDL 120 LEARIQRGIQ SVRSRKEQIL LVQNDFLRNK IAECQCENAS VTLHIYNEAP PQFDTQDLLQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6byy_A	4e-21	1	69	1	69	MEF2 CHIMERA
6byy_B	4e-21	1	69	1	69	MEF2 CHIMERA
6byy_C	4e-21	1	69	1	69	MEF2 CHIMERA
6byy_D	4e-21	1	69	1	69	MEF2 CHIMERA
6bz1_A	4e-21	1	69	1	69	MEF2 CHIMERA
6bz1_B	4e-21	1	69	1	69	MEF2 CHIMERA
6bz1_C	4e-21	1	69	1	69	MEF2 CHIMERA
6bz1_D	4e-21	1	69	1	69	MEF2 CHIMERA
6c9l_A	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Pta.15230	0.0	root

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019067518.1	2e-59	floral homeotic protein AGAMOUS isoform X1
Swissprot	Q40168	6e-59	AG_SOLLC; Floral homeotic protein AGAMOUS
TrEMBL	A0A0A6ZIN2	1e-99	A0A0A6ZIN2_PICAB; MADS-domain transcription factor DAL20
STRING	XP_010272685.1	8e-59	(Nelumbo nucifera)

Publications ? help Back to Top
Pan IL,McQuinn R,Giovannoni JJ,Irish VF Functional diversification of AGAMOUS lineage genes in regulating tomato flower and fruit development. J. Exp. Bot., 2010. 61(6): p. 1795-806 [PMID:20335407] Gimenez E, et al. TOMATO AGAMOUS1 and ARLEQUIN/TOMATO AGAMOUS-LIKE1 MADS-box genes have redundant and divergent functions required for tomato reproductive development. Plant Mol. Biol., 2016. 91(4-5): p. 513-31 [PMID:27125648]