PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pta011597 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
|
||||||||
Family | ARF | ||||||||
Protein Properties | Length: 189aa MW: 21482.6 Da PI: 10.0641 | ||||||||
Description | ARF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 65.2 | 9.9e-21 | 2 | 91 | 13 | 99 |
TT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS B3 13 sgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 +g +++ +++a+e+ +++++ s++l+ +d++g +W++++i+r++++r++lt+GW+ Fv++++L +gD ++F + +++el+v+v+r+ Pta011597 2 HGGFSVLRRHADEClppldMSQQPPSQDLVAKDLHGVEWRFRHIFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFL--RGENGELRVGVRRA 91 577899999**999****9555566789************************************************..449999*****996 PP | |||||||
2 | Auxin_resp | 105.2 | 7.7e-35 | 116 | 189 | 1 | 74 |
Auxin_resp 1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrW 74 a+ha++tk++F+v+Y+Pr+s+seF+++++++++++k+++svGmRfkm+fe+e+++e+r++Gt+vg+sd+dpv+W Pta011597 116 ASHAVTTKTMFSVYYKPRTSPSEFIIPYDQYMESMKINFSVGMRFKMKFEGEEVPEQRFTGTIVGISDADPVNW 189 789**********************************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 11.66 | 1 | 92 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 1.08E-34 | 1 | 119 | IPR015300 | DNA-binding pseudobarrel domain |
CDD | cd10017 | 7.13E-16 | 1 | 90 | No hit | No description |
SMART | SM01019 | 1.5E-11 | 1 | 92 | IPR003340 | B3 DNA binding domain |
Gene3D | G3DSA:2.40.330.10 | 1.1E-35 | 2 | 105 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 2.4E-18 | 2 | 91 | IPR003340 | B3 DNA binding domain |
Pfam | PF06507 | 5.0E-32 | 116 | 189 | IPR010525 | Auxin response factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009725 | Biological Process | response to hormone | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
THGGFSVLRR HADECLPPLD MSQQPPSQDL VAKDLHGVEW RFRHIFRGQP RRHLLTTGWS 60 VFVSSKRLVA GDAFIFLRGE NGELRVGVRR AMRQQNNVPS SVISSHSMHL GVIATASHAV 120 TTKTMFSVYY KPRTSPSEFI IPYDQYMESM KINFSVGMRF KMKFEGEEVP EQRFTGTIVG 180 ISDADPVNW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ldv_A | 1e-106 | 1 | 189 | 135 | 323 | Auxin response factor 1 |
4ldw_A | 1e-106 | 1 | 189 | 135 | 323 | Auxin response factor 1 |
4ldw_B | 1e-106 | 1 | 189 | 135 | 323 | Auxin response factor 1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pta.7907 | 0.0 | xylem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, culms, leaves and young panicles. {ECO:0000269|PubMed:17408882}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). | |||||
UniProt | Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin under light or dark conditions and gravitropic stimulation of coleptile. {ECO:0000269|PubMed:12369618, ECO:0000269|PubMed:17408882}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013645688.1 | 1e-121 | auxin response factor 2 | ||||
Refseq | XP_020090490.1 | 1e-119 | auxin response factor 4-like | ||||
Swissprot | A2ZET6 | 1e-118 | ARFW_ORYSI; Auxin response factor 23 | ||||
Swissprot | Q2R3F5 | 1e-118 | ARFW_ORYSJ; Auxin response factor 23 | ||||
TrEMBL | A0A0C9RYI4 | 1e-119 | A0A0C9RYI4_9SPER; Auxin response factor | ||||
TrEMBL | A0A0P0Y2Y4 | 1e-121 | A0A0P0Y2Y4_ORYSJ; Auxin response factor | ||||
STRING | Gorai.001G054600.1 | 1e-118 | (Gossypium raimondii) | ||||
STRING | OS11T0523800-01 | 1e-121 | (Oryza sativa) |