PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pta011439 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 195aa MW: 22439.4 Da PI: 8.8496 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 175.9 | 1.1e-54 | 6 | 133 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 lppG FhPtdeelv +yLkkkv+g+k+e ++i+evd+yk+ePwdLp k ++++++ +w+fFs+rd+ky++g+r+nrat++gyWkatgkd++v+s +++ Pta011439 6 LPPGSGFHPTDEELVADYLKKKVHGHKIER-DIIPEVDLYKCEPWDLPdKiCLQSKNLQWHFFSPRDRKYPNGSRTNRATEAGYWKATGKDRKVTS-QQS 103 79**************************99.99***************5346666666**************************************.899 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 ++g+kktLvfy+grap ge+tdWvmhey+l Pta011439 104 TIGTKKTLVFYRGRAPLGERTDWVMHEYHL 133 9****************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.71E-60 | 3 | 155 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.1 | 6 | 155 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.5E-27 | 7 | 133 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MAQISLPPGS GFHPTDEELV ADYLKKKVHG HKIERDIIPE VDLYKCEPWD LPDKICLQSK 60 NLQWHFFSPR DRKYPNGSRT NRATEAGYWK ATGKDRKVTS QQSTIGTKKT LVFYRGRAPL 120 GERTDWVMHE YHLDEKECQA AGLQDSFVLC RVVKKNGLGT KSDDQSVAPT EKMIQMVQIT 180 THYLAIWLNI QYPVX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-54 | 1 | 161 | 12 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-54 | 1 | 161 | 12 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-54 | 1 | 161 | 12 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-54 | 1 | 161 | 12 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-54 | 1 | 161 | 15 | 174 | NAC domain-containing protein 19 |
3swm_B | 3e-54 | 1 | 161 | 15 | 174 | NAC domain-containing protein 19 |
3swm_C | 3e-54 | 1 | 161 | 15 | 174 | NAC domain-containing protein 19 |
3swm_D | 3e-54 | 1 | 161 | 15 | 174 | NAC domain-containing protein 19 |
3swp_A | 3e-54 | 1 | 161 | 15 | 174 | NAC domain-containing protein 19 |
3swp_B | 3e-54 | 1 | 161 | 15 | 174 | NAC domain-containing protein 19 |
3swp_C | 3e-54 | 1 | 161 | 15 | 174 | NAC domain-containing protein 19 |
3swp_D | 3e-54 | 1 | 161 | 15 | 174 | NAC domain-containing protein 19 |
4dul_A | 3e-54 | 1 | 161 | 12 | 171 | NAC domain-containing protein 19 |
4dul_B | 3e-54 | 1 | 161 | 12 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010270697.1 | 1e-84 | PREDICTED: NAC domain-containing protein 45 | ||||
Refseq | XP_029124457.1 | 7e-86 | NAC domain-containing protein 86-like | ||||
Swissprot | Q9FFI5 | 3e-77 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
TrEMBL | A0A0C9QTT7 | 3e-92 | A0A0C9QTT7_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_10143_3084 transcribed RNA sequence | ||||
STRING | XP_010270697.1 | 4e-84 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65910.1 | 3e-83 | NAC domain containing protein 28 |
Publications ? help Back to Top | |||
---|---|---|---|
|