PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta008052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family TALE
Protein Properties Length: 316aa    MW: 35407.3 Da    PI: 6.5239
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-80860PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox308.8e-101241611954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  Pta008052 124 FEHflHPYPKDADKHMLARQTGLTRNQVSNWFINARVR 161
                664459******************************88 PP

2BELL105.92.6e-341581572
       BELL 15 lleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
               +l+eVd+rY+qy++q+q+v+ssFea+ag+g+ak YtslAl++iSrhFrcL+dai++qi
  Pta008052  1 MLDEVDQRYRQYYHQMQIVVSSFEAAAGYGAAKTYTSLALQTISRHFRCLRDAISGQI 58
               9********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075262.7E-29155IPR006563POX domain
SMARTSM005741.2E-6156IPR006563POX domain
PROSITE profilePS5007112.179102165IPR001356Homeobox domain
CDDcd000869.63E-12105166No hitNo description
SMARTSM003898.1E-9105169IPR001356Homeobox domain
SuperFamilySSF466892.82E-17107172IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-29108171IPR009057Homeodomain-like
PfamPF059201.4E-18122161IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MLDEVDQRYR QYYHQMQIVV SSFEAAAGYG AAKTYTSLAL QTISRHFRCL RDAISGQIRL  60
TSKSLGEEDS TLSGKGETSR LRFVDQQLRQ QRALQQLGMI QQHAWRPQRG LPERSVSVLR  120
AWLFEHFLHP YPKDADKHML ARQTGLTRNQ VSNWFINARV RLWKPMVEEM YVEETKEAEV  180
DHGSNDKTGK ESGEKKEDAL SKEGAAGNNG NIHEQQSGKI SKLDNIAQDG GADEKPAGVP  240
KSENASNLIN VRNQSFGMGG TSDSQIFNET ENEGIRQGQL KKARNGTQEC TSLLSPNMSI  300
EVDLKSDETN SGEFGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16111169563Homeobox protein Meis2
3k2a_B2e-16111169563Homeobox protein Meis2
4xrs_A2e-16111168158Homeobox protein Meis1
4xrs_B2e-16111168158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011046419.11e-116PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_011046420.11e-116PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_011046421.11e-116PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_011046422.11e-116PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_011046423.11e-116PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SIW13e-95BLH7_ARATH; BEL1-like homeodomain protein 7
TrEMBLA0A0C9RM181e-178A0A0C9RM18_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_11489_4138 transcribed RNA sequence
STRINGPOPTR_0006s21950.11e-115(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.13e-80BEL1-like homeodomain 7
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]