PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta006924
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family TALE
Protein Properties Length: 406aa    MW: 44927.6 Da    PI: 6.693
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-64732PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.68.6e-083553882154
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                k +yp+++e+++L +++gL+ +q+ +WF N+R +
  Pta006924 355 KWPYPTEDEKTRLVQETGLQLKQINNWFINQRKR 388
                469*****************************87 PP

2ELK30.67.7e-11309330122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELKh+L+++Y++++ ++++E++
  Pta006924 309 ELKHELKQGYRSRIEDIREEIL 330
                9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.2E-17140184IPR005540KNOX1
PfamPF037903.1E-15142183IPR005540KNOX1
SMARTSM012561.1E-21195251IPR005541KNOX2
PfamPF037918.7E-16202250IPR005541KNOX2
SMARTSM011880.0016309330IPR005539ELK domain
PROSITE profilePS5121310.301309329IPR005539ELK domain
PfamPF037897.3E-5309330IPR005539ELK domain
PROSITE profilePS5007111.742329392IPR001356Homeobox domain
SMARTSM003894.7E-11331396IPR001356Homeobox domain
SuperFamilySSF466892.4E-16331396IPR009057Homeodomain-like
CDDcd000863.85E-11332391No hitNo description
Gene3DG3DSA:1.10.10.607.8E-25336393IPR009057Homeodomain-like
PfamPF059201.5E-17349388IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
GSGNRFDIKA VIDMNEGSGL KVGATATWLN SLSHHHHHHH PNSHVEGDQS GMMGFSAQQQ  60
HSHGSTIIDH SASAAAAAAG GGGGGGGGGG QGRGMLDLHS DTANSSELLG SSRSDGDHPH  120
HGHHDQQQQQ QENHMVWQNS RLKADVLQHP LYDQLLAAHV ACLRIATPVD QLPKIDAQLA  180
QQHHVVAKYS VLGRNQLLTG EEKEELDRFL AQYVLLLSSF KEQLQQHVRV HAMEAVMACW  240
ELEQSLHTLT GVSPGEGTGA TMSDDEDDQA DSDTNLFDLG LDGQDAVGSF GPLIPTENER  300
SLMERVRQEL KHELKQGYRS RIEDIREEIL RKRRAGKLPG DTTSVLKNWW QAHSKWPYPT  360
EDEKTRLVQE TGLQLKQINN WFINQRKRNW HSNPSSSSAS NAKRKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A2e-13332396872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1385405RKRNWHSNPSSSSASNAKRKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.71020.0embryo| needle| root| shoot| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136985.11e-159hypothetical protein PHAVU_009G090500g
SwissprotP480001e-154KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A3G6J9M70.0A0A3G6J9M7_PINTA; Homeobox protein knotted-1-like 3
STRINGXP_007136985.11e-159(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-144KNOTTED1-like homeobox gene 3
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]