PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta001304
Common NameKn3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family TALE
Protein Properties Length: 470aa    MW: 51908.2 Da    PI: 6.1199
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pta#S20495582PU_unrefUnigeneView CDS
PUT-157a-Pinus_taeda-58750PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.6e-093994312355
                SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                +yps++++  LA+++gL+++q+ +WF N+R ++
  Pta001304 399 PYPSESQKIALAESTGLDQKQINNWFINQRKRH 431
                8*****************************885 PP

2ELK40.36.5e-14351372122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK+qLlrKYsgyL+sLkqEF+
  Pta001304 351 ELKDQLLRKYSGYLSSLKQEFL 372
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012559.4E-16207251IPR005540KNOX1
PfamPF037901.1E-18208249IPR005540KNOX1
SMARTSM012562.5E-24256307IPR005541KNOX2
PfamPF037917.5E-23259306IPR005541KNOX2
SMARTSM011887.1E-8351372IPR005539ELK domain
PROSITE profilePS5121311.592351371IPR005539ELK domain
PfamPF037897.8E-11351372IPR005539ELK domain
PROSITE profilePS5007112.6371434IPR001356Homeobox domain
SMARTSM003894.4E-13373438IPR001356Homeobox domain
SuperFamilySSF466897.7E-19373447IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-27376436IPR009057Homeodomain-like
CDDcd000861.29E-12383435No hitNo description
PfamPF059201.9E-16391430IPR008422Homeobox KN domain
PROSITE patternPS000270409432IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MEHMNTTAQS SSSLYGVHMV EYGGDVGVGS MMALMTEHHP ESESIMTSIP IPSSYSSYSH  60
GHGHGHGHGH GHGQSECLLS AAAMFQTSRP CQGSNKFEPA NAHIGGGGGG GRGAGHFVME  120
QFIPEQAVIS DSSISSVKTE VCSGSGGQFE LIRRKEEGRC GRAYAEPSFV VTPLVTSLPP  180
QQQEGRMVTS LAVDMDSSCS CKPNEADAMR AKIIAHVHYP RLVAAYIDCQ KVGAPPEVVL  240
ELDDLSHKCQ TQHCVPTISV GADPELDQFM EAYCEMFIKY QEELTKPFKE AMAFLKKIEN  300
QLGTLTKGTI RTSSLDQGDE RGDGAASSEE EDGSGGEVEF HEVDPHAEDR ELKDQLLRKY  360
SGYLSSLKQE FLKKKKKGKL PKEARQKLLD WWTRNYKWPY PSESQKIALA ESTGLDQKQI  420
NNWFINQRKR HWKPSEEMQF VVMDSPNPHN AAFFLEGHLR TDGTAFSMDC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.67950.0root| xylem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vegetative meristem. Present in the base of flower primordia (PubMed:26390296). {ECO:0000269|PubMed:12900451, ECO:0000269|PubMed:26390296, ECO:0000269|PubMed:7866029}.
Functional Description ? help Back to Top
Source Description
UniProtMay play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state, and its expression disappears at the same time the shoot apex undergoes the transition from vegetative to reproductive development (PubMed:11934861). Positive regulator of LATERAL ORGAN BOUNDARIES (LOB) (PubMed:11934861). Probably binds to the DNA sequence 5'-TGAC-3' (PubMed:11934861). Able to traffic from the L1 to the L2/L3 layers of the meristem, presumably through plasmodesmata (PubMed:12900451). {ECO:0000269|PubMed:11934861, ECO:0000269|PubMed:12900451, ECO:0000269|PubMed:7866029}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245637.11e-107PREDICTED: homeobox protein knotted-1-like 2
SwissprotP466391e-104KNAT1_ARATH; Homeobox protein knotted-1-like 1
TrEMBLA0A3G6J9U50.0A0A3G6J9U5_PINTA; Homeobox protein knotted-1-like 1
STRINGXP_010245637.11e-107(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-94KNOTTED-like from Arabidopsis thaliana
Publications ? help Back to Top
  1. Guillet-Claude C,Isabel N,Pelgas B,Bousquet J
    The evolutionary implications of knox-I gene duplications in conifers: correlated evidence from phylogeny, gene mapping, and analysis of functional divergence.
    Mol. Biol. Evol., 2004. 21(12): p. 2232-45
    [PMID:15317878]
  2. dela Paz JS, et al.
    Chromosome fragile sites in Arabidopsis harbor matrix attachment regions that may be associated with ancestral chromosome rearrangement events.
    PLoS Genet., 2012. 8(12): p. e1003136
    [PMID:23284301]
  3. Liu C, et al.
    Phosphatidylserine synthase 1 is required for inflorescence meristem and organ development in Arabidopsis.
    J Integr Plant Biol, 2013. 55(8): p. 682-95
    [PMID:23931744]
  4. Liu B, et al.
    NEVERSHED and INFLORESCENCE DEFICIENT IN ABSCISSION are differentially required for cell expansion and cell separation during floral organ abscission in Arabidopsis thaliana.
    J. Exp. Bot., 2013. 64(17): p. 5345-57
    [PMID:23963677]
  5. Simonini S,Kater MM
    Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance.
    J. Exp. Bot., 2014. 65(6): p. 1455-65
    [PMID:24482368]
  6. Scofield S,Dewitte W,Murray JA
    STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1.
    Plant Signal Behav, 2018.
    [PMID:24776954]
  7. Lee JE,Lampugnani ER,Bacic A,Golz JF
    SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis.
    Plant J., 2014. 80(1): p. 122-35
    [PMID:25060324]
  8. Rast-Somssich MI, et al.
    Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta.
    Genes Dev., 2015. 29(22): p. 2391-404
    [PMID:26588991]
  9. Duplat-Bermúdez L,Ruiz-Medrano R,Landsman D,Mariño-Ramírez L,Xoconostle-Cázares B
    Transcriptomic analysis of Arabidopsis overexpressing flowering locus T driven by a meristem-specific promoter that induces early flowering.
    Gene, 2016. 587(2): p. 120-31
    [PMID:27154816]
  10. Li Z, et al.
    Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis.
    J Integr Plant Biol, 2016. 58(12): p. 959-970
    [PMID:27273574]
  11. Lozano-Sotomayor P, et al.
    Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.
    Plant J., 2016. 88(3): p. 437-451
    [PMID:27402171]
  12. Frangedakis E,Saint-Marcoux D,Moody LA,Rabbinowitsch E,Langdale JA
    Nonreciprocal complementation of KNOX gene function in land plants.
    New Phytol., 2017. 216(2): p. 591-604
    [PMID:27886385]
  13. Woerlen N, et al.
    Repression of BLADE-ON-PETIOLE genes by KNOX homeodomain protein BREVIPEDICELLUS is essential for differentiation of secondary xylem in Arabidopsis root.
    Planta, 2017. 245(6): p. 1079-1090
    [PMID:28204875]
  14. Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD
    A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels.
    PLoS ONE, 2017. 12(5): p. e0177045
    [PMID:28493925]
  15. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  16. Simonini S,Stephenson P,Østergaard L
    A molecular framework controlling style morphology in Brassicaceae.
    Development, 2018.
    [PMID:29440299]
  17. Felipo-Benavent A, et al.
    Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction.
    Development, 2019.
    [PMID:30389856]