PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta000339
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family TALE
Protein Properties Length: 475aa    MW: 53154.9 Da    PI: 6.6643
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pta#S20491802PU_unrefUnigeneView CDS
PUT-157a-Pinus_taeda-47933PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-091451821954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  Pta000339 145 FEHflHPYPKDADKHLLARQTGLTRSQVSNWFINARVR 182
                664459******************************88 PP

2BELL124.54.2e-40879172
       BELL  1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
               +rqelq+kkakL+ +l+eVd+rY+qy++q+q+v+ssFe++ag g+ak YtslAlk+iSrhFr+L+daia+qi
  Pta000339  8 DRQELQMKKAKLVAMLDEVDRRYRQYYHQMQIVVSSFETAAGFGAAKTYTSLALKTISRHFRSLRDAIAGQI 79
               699********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.6E-23177IPR006563POX domain
PfamPF075262.8E-37476IPR006563POX domain
PROSITE profilePS5007111.969123186IPR001356Homeobox domain
SMARTSM003896.2E-9126190IPR001356Homeobox domain
CDDcd000862.03E-12126187No hitNo description
SuperFamilySSF466893.29E-17127193IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-29129193IPR009057Homeodomain-like
PfamPF059209.2E-18143182IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
AFGLTPADRQ ELQMKKAKLV AMLDEVDRRY RQYYHQMQIV VSSFETAAGF GAAKTYTSLA  60
LKTISRHFRS LRDAIAGQIR LTSKNLGEED LTGSGKGETS RLHFVDQQLR QQRALQQLGM  120
IQQHAWRPQR GLPERAVSIL RAWLFEHFLH PYPKDADKHL LARQTGLTRS QVSNWFINAR  180
VRLWKPMVEE MYMEELREAE TQNHAADSKV TTESGQNNEE TVSKEGAGNS ENGQEEKSIK  240
NRILNNSIEE GGYIQQNGTV NGGFKPDQAS DRINGRNQTT GMTGVSDSHV FHEIDNEDLR  300
QGQQKKIRTG IQDSTIILPP NMGMDVDLKS EETGSEYILD SSKFASDEKH ASEGYSFANN  360
KMVRLDDNGS FGSYQLGGLS RYGQETFTPK YSGIGGVSLT LGLQHCDDLS LSGTQQSYNS  420
TQGLGSGRRH DLASDTDDYC HIHDASAVRG ASNYDNMSMQ NGKRFATHML HDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A5e-17132189158Homeobox protein Meis1
4xrs_B5e-17132189158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.7080.0root| shoot| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027982.21e-150PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_007027983.21e-150PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_017977082.11e-150PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_017977083.11e-150PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_017977084.11e-150PREDICTED: BEL1-like homeodomain protein 1
TrEMBLA0A0C9RM180.0A0A0C9RM18_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_11489_4138 transcribed RNA sequence
STRINGEOY084861e-148(Theobroma cacao)