PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Psi010792 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 100aa MW: 11066.5 Da PI: 5.564 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 41.9 | 2e-13 | 21 | 56 | 24 | 59 |
EEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 24 YYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 rC+ ++C+vkk+ver+ +d+ ++++tYeg+Hnhe Psi010792 21 ADRCSDNNCSVKKRVERDPSDQGLLITTYEGTHNHE 56 569********************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 14.332 | 1 | 58 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 1.2E-12 | 18 | 58 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.8E-5 | 20 | 57 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.9E-9 | 23 | 56 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.92E-10 | 23 | 58 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
MESWGVIRDN FQSLLENAQS ADRCSDNNCS VKKRVERDPS DQGLLITTYE GTHNHESPSV 60 IYYIGKPIIL PQQGSKPAIV LVNATLCPEP VLNYAAHQAL |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019053770.1 | 1e-14 | PREDICTED: probable WRKY transcription factor 51 isoform X2 | ||||
TrEMBL | A0A0D6RB88 | 6e-30 | A0A0D6RB88_ARACU; Uncharacterized protein | ||||
STRING | XP_010261070.1 | 3e-13 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64810.1 | 3e-14 | WRKY DNA-binding protein 51 |