PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi010097
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family WOX
Protein Properties Length: 148aa    MW: 16461.1 Da    PI: 6.9448
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S49952397PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.38.2e-1115581957
               HHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox 19 Fek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
               ++  n++p+ e+++ +A++l     +   +V++WF+Nr+a+e++
  Psi010097 15 YNGgNQTPKPEQIQVIAAELrrhgTVAGINVFYWFKNRKARERR 58
               66559******************99*****************97 PP

2Wus_type_Homeobox67.13.2e-2213591864
  Wus_type_Homeobox 18 elyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ++y+ G +tP+ e+iq i+aeL+++G + + NVfyWF+NrkaRer+k
          Psi010097 13 NIYNGGNQTPKPEQIQVIAAELRRHGTVAGINVFYWFKNRKARERRK 59
                       79********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF000461.6E-81558IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.1E-41959IPR009057Homeodomain-like
SuperFamilySSF466893.55E-71961IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MEPHKRAAQN PGNIYNGGNQ TPKPEQIQVI AAELRRHGTV AGINVFYWFK NRKARERRKT  60
RSILEGHAAA NSSGFSSFQP NDNFSSRLLN SNGEEDESKF SNCIEVYDFL LNSDAAAAEA  120
GVEVESSLQT LQLFPPSCNE SIAYRNHS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD5ADI81e-94D5ADI8_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.11e-14WUSCHEL related homeobox 1