PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi007367
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 281aa    MW: 28947.2 Da    PI: 10.46
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S38830124PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.33.4e-13235275545
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                +r+rr++kNRe+A rsR+RK+a++ eLe +v +L++eN++ 
  Psi007367 235 RRQRRMIKNRESAARSRARKQAYTVELEAEVNQLKEENTKK 275
                79************************************854 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.2E-13228278No hitNo description
SMARTSM003383.2E-6231280IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.45233281IPR004827Basic-leucine zipper domain
PfamPF001703.1E-11235277IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.21E-9235279No hitNo description
CDDcd147074.92E-23235272No hitNo description
PROSITE patternPS000360238253IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
ALDGEFAANL AERNGDNRLC IGNSLGLGFS ERGHRNGEVG NNKSGAGGVS GLSLSPTNVH  60
PNHAAMDMVN LDAFKHQQQQ TDWLNNHYRN ATAAAFAQQQ HQQQQQQLLH HQAAAEAAAA  120
AAAYATNVKR AGGNAALIGQ GGLGGGLALG GTMGNGGLGA GLGGVGGLGA GLGGPFGPSA  180
LAIGAGSPAS PLSSDGVGPS HVDNPTISPV PYGFDGGMRG RKRGLDGPVE KVVERRQRRM  240
IKNRESAARS RARKQAYTVE LEAEVNQLKE ENTKKKKKRA L
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.47550.0shoot
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028806847.14e-38bZIP transcription factor TRAB1-like
TrEMBLA0A0C9S8B32e-83A0A0C9S8B3_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_11777_3031 transcribed RNA sequence
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.14e-36abscisic acid responsive elements-binding factor 2