PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi006525
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 443aa    MW: 47984.8 Da    PI: 6.4356
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S50071978PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.71.7e-15234288357
                XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                 lkr rrk +NRe+ArrsR+RK+a +  Le  v++L  eN++L k+  e++++++
  Psi006525 234 HLKRVRRKLSNRESARRSRRRKQAHLNDLEIQVAQLRVENSSLFKRFTEINQKYS 288
                58********************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.6E-12229286No hitNo description
SMARTSM003384.8E-17232296IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.082234286IPR004827Basic-leucine zipper domain
PfamPF001709.9E-13234288IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.88E-11236286No hitNo description
PROSITE patternPS000360239254IPR004827Basic-leucine zipper domain
PfamPF124984.6E-15303419IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
XTMDRQFSFS PADDVEGNSM AVITEEEEEE SPVVSGRMSR SASEWAFQKF LNYDGSEIPS  60
EDGEGDHKTL GLKDPLPHGR MDNLSAPLSP LFGEVGDELR KDEVPPPTDP RDHQTFLKRR  120
LNLACAAVAF TRVTGISSPG PGPSTVDANQ SQNTLGSEGR AASLVSQSSA TDARAIYIGA  180
VSSTGSGPIG IPALPPKPKG GNTQVRTTSG SSREQSDDDD QEVGPSEQSM DPSHLKRVRR  240
KLSNRESARR SRRRKQAHLN DLEIQVAQLR VENSSLFKRF TEINQKYSGA SVDNRVLKSD  300
VEALRAKVKM VESMVPKAAT AGFPFQNTSQ VQSAVSLRYT TGIFXLACNN VLQGEDGLYM  360
NTAQSTGTGG SSLSCAISDM NQQNKELQIQ HTGSKMGRTP SMQRVASLEH LQKRIRGGIT  420
CGSMPWGGAW DVDGSQVIEH SEH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1234241LKRVRRKL
2238254RRKLSNRESARRSRRRK
3248255RRSRRRKQ
4250255SRRRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LQ620.0B8LQ62_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.25e-40bZIP family protein