PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi006489
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 456aa    MW: 49544.1 Da    PI: 8.0387
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S50073356PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.15e-10260318563
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                kr++r   NR +A rs +RK  +i eLe++v++L++e ++L  +l +l+     l++e+
  Psi006489 260 KRAKRILANRQSAVRSKERKMRYISELERRVQTLQTEATTLSAQLTMLQRDTTGLTTEN 318
                9*********************************************9998877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-16256320IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.001258321IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-10260314No hitNo description
SuperFamilySSF579594.71E-11260312No hitNo description
PfamPF001701.3E-8260317IPR004827Basic-leucine zipper domain
CDDcd147035.81E-23261310No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MATANAPKNT TGNSLGNPSQ SQQVQQARYV GYPSSTNAFT LTREAKPALS DSSGNSMVMD  60
VTMQEPVSSS GAVGVTEPRN LGPSQNFSTD VSRMPDVPPR RGGHRRAQSE IAFRLPDDIM  120
FDGDLGFSGF DMPTVSDDAT EAEDLISMYM DMEKLTSFGE PLNAVAGEGS KLPLGADTNR  180
APHHSRSLSV DAVFSGLESD LEGTRGNLGS AGPSRPRHRH SNSMDGSSSL QINQLSSESL  240
ETKKAMAAKK LQELALIDPK RAKRILANRQ SAVRSKERKM RYISELERRV QTLQTEATTL  300
SAQLTMLQRD TTGLTTENNE LKLRLQSMEQ QAQLRDALNE TLREKVQRMK IATGQLSSNN  360
ANAFNMSATA QQLPLNRSFF SPTQHSHRLN QQFQSFQHPP SAMNNQPLMG QSQVHQNFPQ  420
YGSAGQLQGL MGSQGGPAVE SEVSSGSVNH PASSSF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.145060.0shoot
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively at a low level in young seedlings and in roots, stems and leaves of mature plants.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024404099.11e-127transcription factor RF2a-like
SwissprotQ040883e-80POF21_ARATH; Probable transcription factor PosF21
TrEMBLB8LLI30.0B8LLI3_PICSI; Uncharacterized protein
STRINGPP1S20_116V6.11e-126(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.16e-84bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]