PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Psi005531 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||||||
Family | NF-YB | ||||||||||||
Protein Properties | Length: 154aa MW: 16929.9 Da PI: 6.2689 | ||||||||||||
Description | NF-YB family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 187.6 | 8.7e-59 | 31 | 126 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 reqdrflPian+srimkk++Panaki+kdak+tvqecvsefisf+tseasdkcqrekrktingddllwa++tlGfedyveplk+yl+kyre+eg++ Psi005531 31 REQDRFLPIANISRIMKKAVPANAKIAKDAKDTVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMGTLGFEDYVEPLKLYLHKYREMEGDS 126 89********************************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.8E-55 | 25 | 141 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.15E-41 | 33 | 141 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.0E-28 | 36 | 100 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.3E-22 | 64 | 82 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 67 | 83 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.3E-22 | 83 | 101 | No hit | No description |
PRINTS | PR00615 | 6.3E-22 | 102 | 120 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MADLASSVTS QESPHSEDTN NNSHNQGSNA REQDRFLPIA NISRIMKKAV PANAKIAKDA 60 KDTVQECVSE FISFITSEAS DKCQREKRKT INGDDLLWAM GTLGFEDYVE PLKLYLHKYR 120 EMEGDSKGAA ASKSGMGDPT KKDLSNFGAV ANIR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 3e-48 | 31 | 121 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 3e-48 | 31 | 121 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Psi.7339 | 0.0 | shoot |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024369282.1 | 1e-68 | nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
Swissprot | P25209 | 8e-66 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
TrEMBL | D5ABK1 | 1e-111 | D5ABK1_PICSI; Uncharacterized protein | ||||
STRING | PP1S25_89V6.1 | 1e-67 | (Physcomitrella patens) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.3 | 5e-66 | nuclear factor Y, subunit B1 |
Publications ? help Back to Top | |||
---|---|---|---|
|