PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi005439
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 159aa    MW: 18077.2 Da    PI: 6.5141
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S50073217PU_unrefUnigeneView CDS
PUT-183a-Picea_sitchensis-13067PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.7e-133896563
               CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
               ++++r+ +NRe+ArrsR RK++ ++eL+ +++ L aeN  +  + +  + ++ +l+ e+
  Psi005439 38 RKQKRMLSNRESARRSRMRKQQHLDELRAEAAHLRAENNHMLTKFNIASHKYMQLEEEN 96
               79***************************************999999888888888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.2E-102981No hitNo description
SMARTSM003384.7E-163498IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.763699IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.22E-123892No hitNo description
PfamPF001704.3E-103896IPR004827Basic-leucine zipper domain
CDDcd147021.15E-213990No hitNo description
PROSITE patternPS0003604156IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MGLNPSVTSS EPSSQVSGSI PHHYSGSEED PKQTIDERKQ KRMLSNRESA RRSRMRKQQH  60
LDELRAEAAH LRAENNHMLT KFNIASHKYM QLEEENSLLR SYATDLSLKL QSLTIAMQWA  120
GVLNDMDLDS STGFMDTTDI KSCYLPSISQ PLTSTEIYQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15057RRSRMRKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the micropylar endosperm and radicle tip in early germinating seeds. {ECO:0000269|PubMed:23461773}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotC0Z2L59e-24BZP44_ARATH; bZIP transcription factor 44
TrEMBLB8LLW51e-114B8LLW5_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.12e-20basic leucine-zipper 2
Publications ? help Back to Top
  1. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  2. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]