PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi005388
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 162aa    MW: 18068.3 Da    PI: 10.6294
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S41649813PU_unrefUnigeneView CDS
PUT-183a-Picea_sitchensis-16039PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.11.2e-1583144162
                XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                +ke kr +r+ +NR++A+  R+RKka++  Le++vke+e +N++L ++l++l++e + l++ 
  Psi005388  83 DKEHKRLKRLLRNRVSAQQARERKKAYLSDLETRVKEIEHKNSELEERLSTLQNENQMLRQI 144
                5899*****************************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000417.1E-58298IPR001630cAMP response element binding (CREB) protein
SMARTSM003381.5E-1583147IPR004827Basic-leucine zipper domain
PfamPF001702.0E-1484145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.47285148IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-1387145No hitNo description
Gene3DG3DSA:1.20.5.1708.2E-1787147No hitNo description
CDDcd147041.45E-1888139No hitNo description
PROSITE patternPS00036090105IPR004827Basic-leucine zipper domain
PRINTSPR000417.1E-5100120IPR001630cAMP response element binding (CREB) protein
PRINTSPR000417.1E-5120137IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MQDTAASTST QHQSTSEKSS SSAAPAQFRL AKDAIESDDD IRRVPEMGGM QAGPSTCLPM  60
RLDNPQPTTG VVAHKKRGRA PADKEHKRLK RLLRNRVSAQ QARERKKAYL SDLETRVKEI  120
EHKNSELEER LSTLQNENQM LRQILKNTTM KKKGSGNSGA ET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_A5e-16108147342Transcription factor HY5
2oqq_B5e-16108147342Transcription factor HY5
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.34730.0shoot
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002324289.15e-52transcription factor HY5 isoform X1
RefseqXP_010250037.16e-52PREDICTED: transcription factor HY5
RefseqXP_013609113.14e-52PREDICTED: transcription factor HY5
RefseqXP_013687403.14e-52transcription factor HY5
SwissprotQ9SM501e-49HY5_SOLLC; Transcription factor HY5
TrEMBLA9NTI71e-115A9NTI7_PICSI; Uncharacterized protein
STRINGPOPTR_0018s01530.12e-51(Populus trichocarpa)
STRINGBo9g171430.11e-51(Brassica oleracea)
STRINGLus100029002e-51(Linum usitatissimum)
STRINGXP_010250037.12e-51(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.19e-50bZIP family protein
Publications ? help Back to Top
  1. Wang F, et al.
    Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato.
    Plant Physiol., 2018. 176(2): p. 1311-1326
    [PMID:29146776]
  2. Liu CC, et al.
    The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato.
    Plant Cell Environ., 2018. 41(8): p. 1762-1775
    [PMID:29566255]