PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Psi005388 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||||||
Family | bZIP | ||||||||||||
Protein Properties | Length: 162aa MW: 18068.3 Da PI: 10.6294 | ||||||||||||
Description | bZIP family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 49.1 | 1.2e-15 | 83 | 144 | 1 | 62 |
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 +ke kr +r+ +NR++A+ R+RKka++ Le++vke+e +N++L ++l++l++e + l++ Psi005388 83 DKEHKRLKRLLRNRVSAQQARERKKAYLSDLETRVKEIEHKNSELEERLSTLQNENQMLRQI 144 5899*****************************************************99886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PRINTS | PR00041 | 7.1E-5 | 82 | 98 | IPR001630 | cAMP response element binding (CREB) protein |
SMART | SM00338 | 1.5E-15 | 83 | 147 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.0E-14 | 84 | 145 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 12.472 | 85 | 148 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.69E-13 | 87 | 145 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 8.2E-17 | 87 | 147 | No hit | No description |
CDD | cd14704 | 1.45E-18 | 88 | 139 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 90 | 105 | IPR004827 | Basic-leucine zipper domain |
PRINTS | PR00041 | 7.1E-5 | 100 | 120 | IPR001630 | cAMP response element binding (CREB) protein |
PRINTS | PR00041 | 7.1E-5 | 120 | 137 | IPR001630 | cAMP response element binding (CREB) protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MQDTAASTST QHQSTSEKSS SSAAPAQFRL AKDAIESDDD IRRVPEMGGM QAGPSTCLPM 60 RLDNPQPTTG VVAHKKRGRA PADKEHKRLK RLLRNRVSAQ QARERKKAYL SDLETRVKEI 120 EHKNSELEER LSTLQNENQM LRQILKNTTM KKKGSGNSGA ET |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2oqq_A | 5e-16 | 108 | 147 | 3 | 42 | Transcription factor HY5 |
2oqq_B | 5e-16 | 108 | 147 | 3 | 42 | Transcription factor HY5 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Psi.3473 | 0.0 | shoot |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002324289.1 | 5e-52 | transcription factor HY5 isoform X1 | ||||
Refseq | XP_010250037.1 | 6e-52 | PREDICTED: transcription factor HY5 | ||||
Refseq | XP_013609113.1 | 4e-52 | PREDICTED: transcription factor HY5 | ||||
Refseq | XP_013687403.1 | 4e-52 | transcription factor HY5 | ||||
Swissprot | Q9SM50 | 1e-49 | HY5_SOLLC; Transcription factor HY5 | ||||
TrEMBL | A9NTI7 | 1e-115 | A9NTI7_PICSI; Uncharacterized protein | ||||
STRING | POPTR_0018s01530.1 | 2e-51 | (Populus trichocarpa) | ||||
STRING | Bo9g171430.1 | 1e-51 | (Brassica oleracea) | ||||
STRING | Lus10002900 | 2e-51 | (Linum usitatissimum) | ||||
STRING | XP_010250037.1 | 2e-51 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11260.1 | 9e-50 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|