PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi005375
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 163aa    MW: 18949.5 Da    PI: 9.1905
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S26094988PU_unrefUnigeneView CDS
PUT-183a-Picea_sitchensis-29585PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.82.8e-1459117563
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                ++++r+ +NRe+ArrsR RK++ ++eL+  v +L aeN    ++ +  ++++ +++ ++
  Psi005375  59 RKQKRMLSNRESARRSRMRKQQHMDELRAQVVQLRAENNHILSKFNIASQHYLQVEEQN 117
                79***************************************999999999998888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.8E-1049102No hitNo description
SMARTSM003384.4E-1755119IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.80657120IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.62E-1259111No hitNo description
PfamPF001707.5E-1159116IPR004827Basic-leucine zipper domain
CDDcd147022.15E-1860110No hitNo description
PROSITE patternPS0003606277IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
XKSSDVQVVM GRRVVFDXEG GKVGTSSYGS CPPSSSHSGS EEEQQEQQQE QKKNVIDERK  60
QKRMLSNRES ARRSRMRKQQ HMDELRAQVV QLRAENNHIL SKFNIASQHY LQVEEQNRVL  120
RSQAIDLYQK LQVLISMQQQ QQQQQQQSLG NFDNLEFQNS GFC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17178RRSRMRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024392804.11e-30basic leucine zipper 63-like
RefseqXP_024392805.11e-30basic leucine zipper 63-like
RefseqXP_024392806.11e-30basic leucine zipper 63-like
RefseqXP_024392808.11e-30basic leucine zipper 63-like
TrEMBLA0A0C9S8791e-40A0A0C9S879_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_5460_974 transcribed RNA sequence
STRINGPP1S158_113V6.15e-30(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.17e-27basic leucine-zipper 44