PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi004868
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 192aa    MW: 20788.5 Da    PI: 8.7551
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S42993120PU_unrefUnigeneView CDS
PUT-183a-Picea_sitchensis-9987PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.67.3e-10346851
               HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1  8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51
               +r   NReA r++R++Kka+++ Lee+v  L++ N++L  +l+ 
  Psi004868  3 KRPVGNREAVRKYREKKKARTASLEEEVLHLTTLNQQLLRRLQG 46
               66677*********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.8E-6163IPR004827Basic-leucine zipper domain
CDDcd146864.22E-11155No hitNo description
PROSITE profilePS502178.841145IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-12263No hitNo description
SuperFamilySSF579592.31E-7246No hitNo description
PfamPF077169.1E-15253IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
QKKRPVGNRE AVRKYREKKK ARTASLEEEV LHLTTLNQQL LRRLQGQAAL EAEIARLKCL  60
LADFRGRIDG ELGSYPYQKS IRMDKTCNDA PFRQPMPGGY VLDPCNIWCN ADAACHDPTL  120
ASNSEGGVQH ERDSGARWNG DCGQISGHCQ GLKGDMAVTS SGLSACSEGT ATKTVPPAVA  180
SSGKERKGAF GV
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012081777.12e-48basic leucine zipper 23 isoform X1
RefseqXP_012081778.19e-49basic leucine zipper 23 isoform X2
RefseqXP_020538022.12e-48basic leucine zipper 23 isoform X1
RefseqXP_020538023.19e-49basic leucine zipper 23 isoform X2
SwissprotQ8GTS21e-41BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0D6R0G46e-76A0A0D6R0G4_ARACU; Uncharacterized protein
STRINGXP_002534148.14e-47(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.16e-32bZIP family protein
Publications ? help Back to Top
  1. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  2. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  3. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]