PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi002276
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family WOX
Protein Properties Length: 358aa    MW: 39855.1 Da    PI: 6.3429
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S41648576PU_unrefUnigeneView CDS
PUT-183a-Picea_sitchensis-349PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.24.4e-2177137257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                r+R+t++++ql++Le+lFe+ + +ps+++++e++++l    +++e++V++WFqNr+a+ k+
  Psi002276  77 RQRWTPSQTQLQILENLFEQgHATPSKQKIKEITMELsqhgQISETNVYNWFQNRKARAKR 137
                89*****************99**************************************97 PP

2Wus_type_Homeobox99.72.2e-3276139265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RWtP+++Q++iLe+l+++G  tP+k++i++it+eL+++G+i+++NV++WFQNrkaR ++kq
          Psi002276  76 ARQRWTPSQTQLQILENLFEQGHATPSKQKIKEITMELSQHGQISETNVYNWFQNRKARAKRKQ 139
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-1672139IPR009057Homeodomain-like
SuperFamilySSF466891.2E-1672139IPR009057Homeodomain-like
PROSITE profilePS5007114.85273138IPR001356Homeobox domain
SMARTSM003893.2E-1375142IPR001356Homeobox domain
PfamPF000461.0E-1877137IPR001356Homeobox domain
CDDcd000863.48E-1377139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MANPNFVALH NNQVMTDEQM ETLRRQICVY STICSQLVEM HRAMSQQQPS SVPTLLMGQH  60
MLYDLAQGNP GFRASARQRW TPSQTQLQIL ENLFEQGHAT PSKQKIKEIT MELSQHGQIS  120
ETNVYNWFQN RKARAKRKQL PSQRGGESEN ETDDEYPGEK RFKPQRDSNA QNPKSGHSEA  180
DPQAPNKSDD VVQHRPCTTD QKQFGIQDND TPSLLPREDE MRPHASFGST MIGVSGSAEH  240
ESVECLPEVK PIYSSVEVGN RDHDATQAYT HGSGTTTGQA DGKPWQVPNV VVDVRRMFGE  300
NAVLVDSRGH MVPTNDMGVS FHPLHASEGY TVLSQYQCAS GVPVHALRAN TSDPYGGT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.62840.0needle| shoot
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NWZ90.0A9NWZ9_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.16e-47WUSCHEL related homeobox 13