PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi001104
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bZIP
Protein Properties Length: 533aa    MW: 58160.7 Da    PI: 6.0253
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S41649446PU_unrefUnigeneView CDS
PUT-183a-Picea_sitchensis-28663PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.68.3e-16327381357
                XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                +lkr rr+ +NRe+ArrsR+RK+a +  Le  v++L  eN +L k+l e+++++ 
  Psi001104 327 DLKRMRRMLSNRESARRSRRRKQAHLSDLEMQVAQLRVENASLFKRLTEMSQKYN 381
                79******************************************88887777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.8E-13320381No hitNo description
SMARTSM003382.8E-17325389IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.427327381IPR004827Basic-leucine zipper domain
PfamPF001701.1E-13328380IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.02E-11329380No hitNo description
CDDcd147022.53E-6330381No hitNo description
PROSITE patternPS000360332347IPR004827Basic-leucine zipper domain
PfamPF124981.3E-19396509IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MERVFSVDDI LGTFWKLDTQ GEGEGETGPS GDTAINRTTT TTKTSMNRSA SEWAFQRFIT  60
EASPIPPPSP SRSPSPHIPN HHDLDHKKKK KPSSSPTPTP PALVNVEEED EAEEEEMRED  120
VKAKKEEEEM REDVKAEKEE EDEKQRNTDK EEEVAAKPVV RNEPSSSSSL VAVNVKPLSP  180
LLKGTGSVME KGVVTHNNPQ DLESFLKQRL DLACAAVALT RASGIDFQGA PPLTFGAQHS  240
QNISMESRAG STVSVAQSSG AGSRPIYNGA LGHIVSQPIG IPALPPKPQS GASQIKTTTS  300
GSSREQTDDD ELEAEIEANQ STMDPSDLKR MRRMLSNRES ARRSRRRKQA HLSDLEMQVA  360
QLRVENASLF KRLTEMSQKY NDAAVDNRIL RADVEALRAK VKMAEDMVAR ATGVGHSIQN  420
TAQISQASGM RYMGGPLESP VTSGLQDSSR YSHSGQPIST QGMPCDISNM NDRNKELLTQ  480
NVGTKMGRTP SMQRVASLEH LQKRIRGGVT CGSTPWSGGW DIEGSPRIEN GGQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1341348RRSRRRKQ
2343348SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.55220.0shoot
Functional Description ? help Back to Top
Source Description
UniProtBinds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011621614.14e-72light-inducible protein CPRF2 isoform X1
RefseqXP_018830240.16e-72PREDICTED: light-inducible protein CPRF2-like isoform X1
RefseqXP_018830241.16e-72PREDICTED: light-inducible protein CPRF2-like isoform X2
SwissprotQ990901e-59CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLA9NUK00.0A9NUK0_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.21e-44bZIP family protein
Publications ? help Back to Top
  1. Weisshaar B,Armstrong GA,Block A,da Costa e Silva O,Hahlbrock K
    Light-inducible and constitutively expressed DNA-binding proteins recognizing a plant promoter element with functional relevance in light responsiveness.
    EMBO J., 1991. 10(7): p. 1777-86
    [PMID:2050115]