PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | model.Picochlorum_contig_111.g391.t1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Picochlorum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 100aa MW: 11353.9 Da PI: 8.7197 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 132.4 | 1.5e-41 | 1 | 81 | 17 | 97 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 mk+ lP+naki+kdak++vqecvsefisf+tseasdkcqrekrktingddllwa+ l f++y++pl++yl+k+r model.Picochlorum_contig_111.g391.t1 1 MKRSLPKNAKIAKDAKDVVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMDVLFFKEYLQPLTLYLQKFR 75 9************************************************************************** PP NF-YB 92 elegek 97 e+e+++ model.Picochlorum_contig_111.g391.t1 76 EAEKNE 81 **9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 2.51E-31 | 1 | 92 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.8E-21 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 9.5E-41 | 1 | 95 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 5.3E-17 | 19 | 37 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 5.3E-17 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 5.3E-17 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
MKRSLPKNAK IAKDAKDVVQ ECVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMDVLFF 60 KEYLQPLTLY LQKFREAEKN ENKSQGHKAS THAESAKGD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 7e-35 | 1 | 76 | 18 | 93 | NF-YB |
4awl_B | 7e-35 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 7e-35 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002949581.1 | 3e-44 | hypothetical protein VOLCADRAFT_117284 | ||||
Swissprot | O23310 | 9e-42 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
Swissprot | Q9SLG0 | 6e-42 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
TrEMBL | A0A0I9QPW0 | 5e-43 | A0A0I9QPW0_VOLCA; CCAAT-box binding factor HAP3-like protein | ||||
STRING | XP_002949581.1 | 1e-43 | (Volvox carteri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP2023 | 16 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.3 | 2e-44 | nuclear factor Y, subunit B1 |
Publications ? help Back to Top | |||
---|---|---|---|
|