PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.8G184500.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 137aa MW: 15842.4 Da PI: 10.7442 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 26.2 | 1.8e-08 | 35 | 90 | 5 | 60 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 kr++r + NR +A + qRKk+++ Le + L e aL +l+ + + + Prupe.8G184500.1.p 35 KRAKRIMTNRRSAMKAKQRKKMYVSALEYNLERLYCEAAALSARLNLWMTDALYIH 90 9*********************************************9988776655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 0.0057 | 31 | 95 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.55E-8 | 35 | 84 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 6.5E-6 | 35 | 90 | No hit | No description |
CDD | cd14703 | 2.27E-13 | 36 | 85 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MADSTPPKNH SASSITSMKK NPPAVLADMA RHDPKRAKRI MTNRRSAMKA KQRKKMYVSA 60 LEYNLERLYC EAAALSARLN LWMTDALYIH ADNKRLRQCL HHIVQQIRLQ DTLMDETQKE 120 IQDLKRIVWS HKTSKN* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.8G184500.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020425913.1 | 1e-96 | transcription factor RF2a | ||||
TrEMBL | A0A251MZV3 | 3e-95 | A0A251MZV3_PRUPE; Uncharacterized protein | ||||
STRING | XP_008235854.1 | 4e-95 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF22886 | 4 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06070.1 | 6e-21 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.8G184500.1.p |