PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G183300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WOX
Protein Properties Length: 255aa    MW: 29269.8 Da    PI: 6.405
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G183300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.44.4e-2289149257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         r+R+t+t+ ql++Le+lFe+ n +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  Prupe.7G183300.2.p  89 RQRWTPTPVQLQILERLFEQgNGTPSKQKIKEITSELsqhgQISETNVYNWFQNRRARSKR 149
                         89*****************99**************************************97 PP

2Wus_type_Homeobox101.84.8e-3388151265
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         ar+RWtPtp Q++iLe+l+++G  tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
  Prupe.7G183300.2.p  88 ARQRWTPTPVQLQILERLFEQGNGTPSKQKIKEITSELSQHGQISETNVYNWFQNRRARSKRKQ 151
                         789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-1884154IPR009057Homeodomain-like
PROSITE profilePS5007115.3785150IPR001356Homeobox domain
SMARTSM003895.8E-1587154IPR001356Homeobox domain
SuperFamilySSF466892.69E-1988154IPR009057Homeodomain-like
PfamPF000467.2E-2089149IPR001356Homeobox domain
CDDcd000868.45E-1389151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MMEWEKLQQK EHEMDGQANG NGGVLYVKVM TDEQLETLRK QIAVYASICE QLVEMHKNLT  60
AQQDLAGVRM GNLYCDPLMT SAGHKITARQ RWTPTPVQLQ ILERLFEQGN GTPSKQKIKE  120
ITSELSQHGQ ISETNVYNWF QNRRARSKRK QQNAACNHAE SEVETEVDSP KDKKTRPEEL  180
FQSQQNSAQR TEDLCFQSPE ISSDLHFLDP QTTKTDKMFP SNSGLRTSRH LSEMSFYDEV  240
LSNSTEPQKF KLRE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142150RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G183300.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007203410.20.0WUSCHEL-related homeobox 8
SwissprotO817886e-91WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLA0A251NDA40.0A0A251NDA4_PRUPE; Uncharacterized protein
STRINGXP_008241933.11e-177(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.12e-93WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]