PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G088900.2.p
Common NamePRUPE_ppa019793mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WOX
Protein Properties Length: 250aa    MW: 28667.4 Da    PI: 8.9079
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G088900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.2e-20968357
                        --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        +R+++t+eql +Lee+++   r+p+a+++++++++l    +++ ++V++WFqN++a++++
  Prupe.6G088900.2.p  9 SRWCPTPEQLMILEEMYRAgIRTPNASQIQHITAQLslygKIEGKNVFYWFQNHKARDRQ 68
                        8*****************99*************************************996 PP

2Wus_type_Homeobox1192.1e-38769264
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        +++RW+PtpeQ++iLee+y++G+rtPn+++iq+ita+L+ yGkie+kNVfyWFQN+kaR+rqk
  Prupe.6G088900.2.p  7 SSSRWCPTPEQLMILEEMYRAGIRTPNASQIQHITAQLSLYGKIEGKNVFYWFQNHKARDRQK 69
                        689***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.398469IPR001356Homeobox domain
SMARTSM003895.9E-7673IPR001356Homeobox domain
SuperFamilySSF466891.71E-11969IPR009057Homeodomain-like
PfamPF000464.4E-18968IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.9E-8968IPR009057Homeodomain-like
CDDcd000861.15E-51069No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MSPAANSSSR WCPTPEQLMI LEEMYRAGIR TPNASQIQHI TAQLSLYGKI EGKNVFYWFQ  60
NHKARDRQKL RRKLCKQLQQ QQLLYNHHHN YHNYHNNPYH HHHHHQQQQQ QQQSLLGYLD  120
HLSPPASSSA LQQLSNCHNY SSAGFLPPPQ VGVEDALMNQ AWKMEIPQRV EMEKSVMSMY  180
GRDWMMMMMM EDVGPPSPCC STSTRATTTR QPLKTLQLFP ITATNLKEES SSPSSSNPLS  240
PPTTPTPNY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G088900.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007208702.20.0WUSCHEL-related homeobox 3 isoform X1
TrEMBLM5W9A30.0M5W9A3_PRUPE; Uncharacterized protein
STRINGEMJ099010.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.12e-42WOX family protein