PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.5G028400.6.p | ||||||||
Common Name | PRUPE_ppa006472mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 271aa MW: 30705.4 Da PI: 10.7011 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 93.6 | 1.6e-29 | 215 | 265 | 2 | 52 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+ Prupe.5G028400.6.p 215 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQM 265 9*************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 6.09E-14 | 212 | 265 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 5.4E-26 | 213 | 265 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.8E-21 | 215 | 265 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 1.4E-6 | 216 | 265 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 271 aa Download sequence Send to blast |
MELFPAQPDL SLQISPPNSK PTSSSSWRRS SREEQEEVDL GFWRRALDSR TSFSSSMAKP 60 DTGFELEVSN PRVYAHGLHH HHHQHHQSNI SSNHIIHHLN QNGNVFQGFE QNQFSVPQVN 120 HHPLLNVHDQ QLQLQSQSQS DHLGFLRPIR GIPVYQNPPP PNLFPFSSQK PLDSNSCTST 180 STITSSSSPL FQAQGGLLRS RFLSRFPAKR SMRAPRMRWT TTLHARFVHA VELLGGHERA 240 TPKSVLELMD VKDLTLAHVK SHLQMRLRNP * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4k_A | 4e-14 | 216 | 264 | 4 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4k_B | 4e-14 | 216 | 264 | 4 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_A | 4e-14 | 216 | 264 | 4 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_C | 4e-14 | 216 | 264 | 4 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_D | 4e-14 | 216 | 264 | 4 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_F | 4e-14 | 216 | 264 | 4 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_H | 4e-14 | 216 | 264 | 4 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_J | 4e-14 | 216 | 264 | 4 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In globular embryos, expressed in the peripheral cells in a basal region above the hypophysis. In heart-stage embryos, expressed in the periphery of the presumptive hypocotyl and on the abaxial side of cotyledon primordia. During vegetative growth, expressed the abaxial side of very young leaf primordia. Expressed on the abaxial side of carpel primordia and then in a localized region on the abaxial margin that gives rise to the septum. Later, expressed in the tissue that gives rise to ovules. {ECO:0000269|PubMed:11525739}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in developing phloem and lateral root. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269|PubMed:11395775, ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928, ECO:0000269|PubMed:18849474, ECO:0000269|PubMed:20179097}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00174 | DAP | Transfer from AT1G32240 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.5G028400.6.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269|PubMed:18849474}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007209201.1 | 0.0 | probable transcription factor KAN2 isoform X1 | ||||
Swissprot | Q93WJ9 | 2e-38 | KAN1_ARATH; Transcription repressor KAN1 | ||||
TrEMBL | A0A251P2Z1 | 0.0 | A0A251P2Z1_PRUPE; Uncharacterized protein | ||||
STRING | EMJ10400 | 0.0 | (Prunus persica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G32240.1 | 1e-38 | G2-like family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.5G028400.6.p |
Entrez Gene | 18776093 |