PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.4G242700.1.p | ||||||||
Common Name | PRUPE_ppa011714mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 200aa MW: 21409.6 Da PI: 7.2146 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 183.7 | 1.4e-57 | 22 | 117 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 reqdr+lPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplkvyl+++re Prupe.4G242700.1.p 22 REQDRLLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYLQRFRE 112 89***************************************************************************************** PP NF-YB 93 legek 97 +egek Prupe.4G242700.1.p 113 MEGEK 117 ***97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.4E-56 | 16 | 153 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.73E-41 | 24 | 128 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.2E-27 | 27 | 91 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.1E-21 | 55 | 73 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 58 | 74 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 8.1E-21 | 74 | 92 | No hit | No description |
PRINTS | PR00615 | 8.1E-21 | 93 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MADSDNDSGG AHTKSNSELS PREQDRLLPI ANVSRIMKKA LPANAKISKD AKETVQECVS 60 EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFEEYV EPLKVYLQRF REMEGEKSSV 120 AARDKDASGG GGNGGVGYES GGGSGGAGVY WQQQQQQQQH QHQHQHQGHV YGGSGFHQMG 180 VSGVGLGKGG PGSNMGRPR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 1e-47 | 19 | 112 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-47 | 19 | 112 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
5g49_A | 1e-47 | 17 | 112 | 2 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.4G242700.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007212085.1 | 1e-146 | nuclear transcription factor Y subunit B-3 | ||||
Swissprot | O23310 | 9e-72 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | M5WHU0 | 1e-145 | M5WHU0_PRUPE; Uncharacterized protein | ||||
STRING | EMJ13284 | 1e-145 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 5e-74 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.4G242700.1.p |
Entrez Gene | 18781428 |
Publications ? help Back to Top | |||
---|---|---|---|
|